Peptide Products
You are here:  Products » Peptide Products » Catalog Peptides - Hot Products »  Calcitonin, rat   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
Calcitonin, rat

Cat. No. Size Price Figures
RP11098-0.5 mg
 		0.5 mg
$ 71.25
MSDS:  20080814024925  (PDF)

STRUCTURE:
Calcitonin, rat Structure
Zoom

References:
  • Gonen E, et al. Effects of pregnancy and lactation on bone mineral density, and their relation to the serum calcium, phosphorus, calcitonin and parathyroid hormone levels in rats. J. Endocrinol. Invest. Apr 2005; 28(4): 322-326.
  • Furue H, et al. Spinal anti-nociceptive effect of calcitonin in an osteoporotic model rat--functional recovery of descending serotonergic inhibition. Clin. Calcium. Mar 2005; 15(3): 163-167.
  • Claro FA, et al. Porous polyethylene for tissue engineering applications in diabetic rats treated with calcitonin: histomorphometric analysis. Int. J. Oral. Maxillofac. Implants. Mar-Apr 2005; 20(2): 211-219.
Full Name
Calcitonin, rat
Alias Thyrocalcitonin
Sequence
(one-letter code)		 CGNLSTCMLGTYTQDLNKFHTFPQTSIGVGAP-NH2
Sequence
(three-letter code)		{CYS}{GLY}{ASN}{LEU}{SER}{THR}{CYS}{MET}{LEU}{GLY}
{THR}{TYR}{THR}{GLN}{ASP}{LEU}{ASN}{LYS}{PHE}{HIS}
{THR}{PHE}{PRO}{GLN}{THR}{SER}{ILE}{GLY}{VAL}{GLY}
{ALA}{PRO}-NH2
C-TerminalNH2
Chemical BridgeDisulfide bridge: Cys1-Cys7
DescriptionCalcitonin (rat) is an hypocalcemic hormone produced by the parafollicular C cells of the thyroid or by the ultimobranchial bodies of nonmammalian vertebrates. Calcitonin decreases blood calcium and phosphate due to inhibition of resorption by osteoblasts and osteocytes.
SolubilitySoluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
FormulaC148H228N40O46S3
M.W.3399.83
Cas11118-25-5
Purity> 95%
StorageStore at -20°C.
NotesCalcitonin (rat)is a 32 amino acid polypeptide, 8 of which are conserved across all species.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP11099peptide : Calcitonin, salmon0.5 mg
$ 57.00
RP11096 peptide : Calcitonin, chicken0.5 mg
$ 71.25
RP12786peptide : Calcitonin, eel1 mg
$ 109.25
5 mg
$ 451.25
RP11095 peptide : Calcitonin Gene Related Peptide (CGRP), rat0.5 mg
$ 128.25
RP11093peptide : Calcitonin Gene Related Peptide (CGRP), chicken0.5 mg
$ 118.75
RP11092 peptide : Calcitonin Gene Related Peptide (CGRP) II, rat0.5 mg
$ 118.75
RP11090peptide : Calcitonin Gene Related Peptide (CGRP) (8-37), rat0.5 mg
$ 90.25
RP11089 peptide : Calcitonin Gene Related Peptide (CGRP) (8-37), human0.5 mg
$ 90.25
RP13606peptide : Calcitonin (8-32), salmon0.2 mg
$ 137.75




Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.