You are here:  Products » Peptide Products » Catalog Peptides - Hot Products »  Calcitonin, salmon   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
Calcitonin, salmon

Cat. No. Size Price Figures
RP11099-0.5 mg
0.5 mg
$ 57.00
HPLC:  20060721145620  (PDF)
MS:  20060721145600  (PDF)
MSDS:  20080814033032  (PDF)

STRUCTURE:
Calcitonin, salmon Structure
Zoom

References:
  • Schweitzer-Stenner R, et al. Salmon calcitonin and amyloid beta: two peptides with amyloidogenic capacity adopt different conformational manifolds in their unfolded states. Biochemistry. Mar 2006; 45(9): 2810-2819.
  • Sahin F, et al. Efficacy of salmon calcitonin in complex regional pain syndrome (type 1) in addition to physical therapy. Clin. Rheumatol. Mar 2006; 25(2): 143-148.
  • Ofluoglu D, et al. Early effect of nasal salmon calcitonin on the bone marker Crosslaps. Rheumatol. Int. Feb 2006; 26(4): 288-291.
Full Name
Calcitonin, salmon
Alias Thyrocalcitonin
Sequence
(one-letter code)
CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2
Sequence
(three-letter code)
{CYS}{SER}{ASN}{LEU}{SER}{THR}{CYS}{VAL}{LEU}{GLY}
{LYS}{LEU}{SER}{GLN}{GLU}{LEU}{HIS}{LYS}{LEU}{GLN}
{THR}{TYR}{PRO}{ARG}{THR}{ASN}{THR}{GLY}{SER}{GLY}
{THR}{PRO}-NH2
C-TerminalNH2
Chemical BridgeDisulfide bridge: Cys1-Cys7
DescriptionCalcitonin (salmon) is an hypocalcemic hormone produced by the parafollicular C cells of the thyroid or by the ultimobranchial bodies of nonmammalian vertebrates. Calcitonin decreases blood calcium and phosphate due to inhibition of resorption by osteoblasts and osteocytes. Calcitonin contains a single disulfide bond, which causes the amino terminus to assume the shape of a ring. Alternative splicing of the calcitonin pre-mRNA can yield a mRNA encoding calcitonin gene-related peptide; that peptide appears to function in the nervous and vascular systems. The calcitonin receptor has been cloned and shown to be a member of the seven-transmembrane, G protein-coupled receptor family.
SolubilitySoluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
FormulaC145H240N44O48S2
M.W.3431.9
Cas47931-85-1
Purity> 95%
StorageStore at -20°C.
NotesCalcitonin is a 32 amino acid polypeptide, 8 of which are conserved across all species.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP11098peptide : Calcitonin, rat0.5 mg
$ 71.25
RP11096 peptide : Calcitonin, chicken0.5 mg
$ 71.25
RP12786peptide : Calcitonin, eel1 mg
$ 109.25
5 mg
$ 451.25
RP11095 peptide : Calcitonin Gene Related Peptide (CGRP), rat0.5 mg
$ 128.25
RP11093peptide : Calcitonin Gene Related Peptide (CGRP), chicken0.5 mg
$ 118.75
RP11092 peptide : Calcitonin Gene Related Peptide (CGRP) II, rat0.5 mg
$ 118.75
RP11090peptide : Calcitonin Gene Related Peptide (CGRP) (8-37), rat0.5 mg
$ 90.25
RP11089 peptide : Calcitonin Gene Related Peptide (CGRP) (8-37), human0.5 mg
$ 90.25
RP13606peptide : Calcitonin (8-32), salmon0.2 mg
$ 137.75




Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.