You are here:  Products » Peptides&Biochemicals » Catalog Peptides - Hot Products »  Brain Natriuretic Peptide (BNP) (1-32), human   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
Brain Natriuretic Peptide (BNP) (1-32), human

Cat. No. Size Price Figures
RP11119-0.5 mg
0.5 mg
$ 109.00
HPLC:  20100603210241  (PDF)
MSDS:  20080922213556  (PDF)
PROTOCOL:  20100407015038  (PDF)
MS:  20100603210344  (PDF)

STRUCTURE:
BNP (1-32) Structure
Zoom

References:
  • Brandt I, et al. Dipeptidyl-peptidase IV converts intact B-type natriuretic peptide into its des-SerPro form. Clin. Chem. Jan 2006; 52(1): 82-87.
  • Prontera C, et al. Comparison of a fully automated immunoassay with a point-of-care testing method for B-type natriuretic peptide. Clin. Chem. Jul 2005; 51(7): 1274-1276.
  • Sengenes C, et al. Natriuretic peptide-dependent lipolysis in fat cells is a primate specificity. Am. J. Physiol. Regul. Integr. Comp. Physiol. Jul 2002; 283(1): R257-265.
Full Name
Brain Natriuretic Peptide (BNP) (1-32), human
Alias Brain Natriuretic Peptide(1-32), human
Sequence
(one-letter code)
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26)
Sequence
(three-letter code)
{SER}{PRO}{LYS}{MET}{VAL}{GLN}{GLY}{SER}{GLY}{CYS}
{PHE}{GLY}{ARG}{LYS}{MET}{ASP}{ARG}{ILE}{SER}{SER}
{SER}{SER}{GLY}{LEU}{GLY}{CYS}{LYS}{VAL}{LEU}{ARG}
{ARG}{HIS}
Chemical BridgeDisulfide bridge: Cys10-Cys26
DescriptionBrain natriuretic peptide (type B natriuretic peptide, BNP) was originally isolated from brain, but is mainly produced in myoendocrine cells of the heart ventricles from which it is released into the circulatory system. BNP is involved in blood pressure control and cardiovascular homeostasis.
SolubilityThe peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
FormulaC143H244N50O42S4
M.W.3464.1
Cas114471-18-0
Purity> 95%
StorageStore the peptide at -20°C.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP11121peptide : Brain Natriuretic Peptide (BNP) (1-32), rat0.5 mg
$ 109.00
RP11110 peptide : C-Type Natriuretic Peptide (CNP) (1-22), human0.5 mg
$ 86.00
RP13529peptide : C-Type Natriuretic Peptide (CNP), frog0.2 mg
$ 66.00
RP11926 peptide : [Thr1-Ala2-Pro3-Arg4]-Atrial Natriuretic Peptide (ANP) (Urodilatin), human0.5 mg
$ 114.00
RP11927peptide : Atrial Natriuretic Peptide (ANP) (1-28), human, porcine0.5 mg
$ 95.00
RP11112 peptide : C-Type Natriuretic Peptide (CNP), chicken0.5 mg
$ 81.00
RP11191peptide : Atrial Natriuretic Peptide (ANP) (1-30), frog0.5 mg
$ 128.00




1
Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
2
Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptideTM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
3
Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
4
Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.




Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.