You are here:  Products » Peptides&Biochemicals » Catalog Peptides - Hot Products »  Brain Natriuretic Peptide (BNP) (1-32), rat   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
Brain Natriuretic Peptide (BNP) (1-32), rat

Cat. No. Size Price Figures
RP11121-0.5 mg
0.5 mg
$ 109.00
MS:  20060721145600  (PDF)
HPLC:  20060721145620  (PDF)
MSDS:  20080707040053  (PDF)
PROTOCOL:  20100407015038  (PDF)


References:
  • Yu YC, et al. Modulation by brain natriuretic peptide of GABA receptors on rat retinal ON-type bipolar cells. J. Neurosci. Jan 2006; 26(2): 696-707.
  • Medvedev A, et al. Natriuretic peptide interaction with [3H]isatin binding sites in rat brain. Brain Res. May 2005; 1042(2): 119-124.
  • Jiang W, et al. Changes in production and metabolism of brain natriuretic peptide in rats with myocardial necrosis. Eur. J. Pharmacol. Jan 2005; 507(1-3): 153-162.
Full Name
Brain Natriuretic Peptide (BNP) (1-32), rat
Alias BNP (1-32), rat
Sequence
(one-letter code)
NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF
Sequence
(three-letter code)
{ASN}{SER}{LYS}{MET}{ALA}{HIS}{SER}{SER}{SER}{CYS}
{PHE}{GLY}{GLN}{LYS}{ILE}{ASP}{ARG}{ILE}{GLY}{ALA}
{VAL}{SER}{ARG}{LEU}{GLY}{CYS}{ASP}{GLY}{LEU}{ARG}
{LEU}{PHE}
Chemical BridgeDisulfide bridge: Cys10-Cys26
DescriptionBrain natriuretic peptide (type B natriuretic peptide) was originally isolated from brain, but is mainly produced in myoendocrine cells of the heart ventricles from which it is released into the circulation. BNP is involved in blood pressure control and cardiovascular homeostasis.
SolubilitySoluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
FormulaC146H239N47O44S3
M.W.3452.94
Cas133448-20-1
Purity> 95%
StorageStore at -20°C. Keep tightly closed.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP11119peptide : Brain Natriuretic Peptide (BNP) (1-32), human0.5 mg
$ 109.00
RP11110 peptide : C-Type Natriuretic Peptide (CNP) (1-22), human0.5 mg
$ 86.00
RP13529peptide : C-Type Natriuretic Peptide (CNP), frog0.2 mg
$ 66.00
RP11926 peptide : [Thr1-Ala2-Pro3-Arg4]-Atrial Natriuretic Peptide (ANP) (Urodilatin), human0.5 mg
$ 114.00
RP13544peptide : Atrial Natriuretic Peptide (ANP), eel0.2 mg
$ 142.00
RP11195 peptide : Atrial Natriuretic Peptide (ANP) (1-28), rat0.5 mg
$ 114.00
RP11927peptide : Atrial Natriuretic Peptide (ANP) (1-28), human, porcine0.5 mg
$ 95.00
RP11112 peptide : C-Type Natriuretic Peptide (CNP), chicken0.5 mg
$ 81.00
RP11191peptide : Atrial Natriuretic Peptide (ANP) (1-30), frog0.5 mg
$ 128.00
RP11190 peptide : Atrial Natriuretic Peptide (ANP) (1-11), rat1 mg
$ 38.00




1
Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
2
Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptideTM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
3
Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
4
Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.




Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.