Peptide Products
You are here:  Products » Peptide Products » Catalog Peptides - Hot Products »  Cecropin B   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
Cecropin B

Cat. No. Size Price Figures
RP11225-0.5 mg
 		0.5 mg
$ 137.75
MSDS:  20080702213335  (PDF)


References:
  • Ferre R, et al. Inhibition of plant-pathogenic bacteria by short synthetic cecropin A-melittin hybrid peptides. Appl. Environ. Microbiol. May 2006; 72(5): 3302-3308.
  • Chen HM, et al. Distinguishing between different pathways of bilayer disruption by the related antimicrobial peptides cecropin B, B1 and B3. Eur. J. Biochem. Mar 2003; 270(5): 911-920.
  • Papo N, et al. Inhibition of tumor growth and elimination of multiple metastases in human prostate and breast xenografts by systemic inoculation of a host defense-like lytic peptide. Cancer Res. May 2006; 66(10): 5371-5378.
Full Name
Cecropin B
Sequence
(one-letter code)		 KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2
Sequence
(three-letter code)		{LYS}{TRP}{LYS}{VAL}{PHE}{LYS}{LYS}{ILE}{GLU}{LYS}
{MET}{GLY}{ARG}{ASN}{ILE}{ARG}{ASN}{GLY}{ILE}{VAL}
{LYS}{ALA}{GLY}{PRO}{ALA}{ILE}{ALA}{VAL}{LEU}{GLY}
{GLU}{ALA}{LYS}{ALA}{LEU}-NH2
C-TerminalNH2
DescriptionCecropins are produced by insects, particularly under conditions of infection. Cecropins are bioactive peptides that interact with membranes and form transmembrane channels that allow the free flow of electrolytes, metabolites, and water across the phospholipid bilayers. Anti-cecropin B is useful for the detection of cecropin B in various immunological assays. Cecropin B has been modified in some instances by substituting a single amino acid to render the molecule less susceptible to proteolytic cleavage.
SolubilitySoluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
FormulaC176H302N52O41S1
M.W.3834.7
Cas80451-05-4
Purity> 95%
StorageThe peptide may be stored at 4°C for short period. For long-term storage, store at -20°C. Aliquots remain stable for at least 24 months at -20°C.
NotesThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
* For Non-Clinical Research Use Only *


Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.