You are here:  Products » Peptide Products » Catalog Peptides - Hot Products »  Amylin (8-37), amide, rat   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
Amylin (8-37), amide, rat

Cat. No. Size Price Figures
RP11277-0.5 mg
0.5 mg
$ 81.00
HPLC:  20050919140132  (PDF)
MASS SPECE:  20050919140154  (PDF)
MSDS:  20080709222201  (PDF)


References:
  • Kaygisiz Z, et al. The effect of adrenomedullin, amylin fragment 8-37 and calcitonin gene-related peptide on contractile force, heart rate and coronary perfusion pressure in isolated rat hearts. Acta Physiol Hung. 2003; 90(2): 133-146.
  • Ye JM, et al. Evidence that amylin stimulates lipolysis in vivo: a possible mediator of induced insulin resistance. Am. J. Physiol. Endocrinol. Metab. Apr 2001; 280(4): E562-569.
  • Reidelberger RD, et al. Amylin receptor blockade stimulates food intake in rats. Am. J. Physiol. Regul. Integr. Comp. Physiol. Sep 2004; 287(3): R568-R574.
Full Name
Amylin (8-37), amide, rat
Alias Amylin (8-37), amide; amylin pharmaceuticals; muraglitazar; oxyntomodulin; symlin, Diabetes Associated Peptide (8-37), amide
Sequence
(one-letter code)
ATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2
Sequence
(three-letter code)
{ALA}{THR}{GLN}{ARG}{LEU}{ALA}{ASN}{PHE}{LEU}{VAL}
{ARG}{SER}{SER}{ASN}{ASN}{LEU}{GLY}{PRO}{VAL}{LEU}
{PRO}{PRO}{THR}{ASN}{VAL}{GLY}{SER}{ASN}{THR}{TYR}-NH2
C-TerminalNH2
DescriptionAmylin is a 37-aa peptide produced in the pancreatic beta-cell secretory granules and Amylin is co-released with insulin. Amylin has specific binding sites in the CNS and Amylin may regulate gastric emptying and influence carbohydrate metabolism.
SolubilitySoluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
FormulaC140H227N43O43
M.W.3200.6
Purity> 95%
StorageStore at -20°C. Keep tightly closed.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP11280peptide : Amylin, amide, rat0.5 mg
$ 109.00
RP13732 peptide : Amylin, feline0.5 mg
$ 238.00
RP11276peptide : Amylin (8-37), human0.5 mg
$ 128.00
RP11293 peptide : Adrenomedullin (AM) (22-52), human0.5 mg
$ 90.00
RP11278peptide : Amylin, human, amide0.5 mg
$ 138.00




1
Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
2
Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptideTM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
3
Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
4
Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.




Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.