| |
Amylin (8-37), amide, rat  |
|
|

| Cat. No. |
Size |
Price |
Figures |
RP11277-0.5 mg
| 0.5 mg | $ 81.00 | HPLC: 20050919140132 (PDF) MASS SPECE: 20050919140154 (PDF) MSDS: 20080709222201 (PDF) PROTOCOL: 20100407015038 (PDF)
References:
- Kaygisiz Z, et al. The effect of adrenomedullin, amylin fragment 8-37 and calcitonin gene-related peptide on contractile force, heart rate and coronary perfusion pressure in isolated rat hearts. Acta Physiol Hung. 2003; 90(2): 133-146.
- Ye JM, et al. Evidence that amylin stimulates lipolysis in vivo: a possible mediator of induced insulin resistance. Am. J. Physiol. Endocrinol. Metab. Apr 2001; 280(4): E562-569.
- Reidelberger RD, et al. Amylin receptor blockade stimulates food intake in rats. Am. J. Physiol. Regul. Integr. Comp. Physiol. Sep 2004; 287(3): R568-R574.
|
|---|
| Full Name | | Amylin (8-37), amide, rat |
|
| Alias |
Amylin (8-37), amide; amylin pharmaceuticals; muraglitazar; oxyntomodulin; symlin, Diabetes Associated Peptide (8-37), amide |
Sequence (one-letter code) |
ATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 | Sequence (three-letter code) | {ALA}{THR}{GLN}{ARG}{LEU}{ALA}{ASN}{PHE}{LEU}{VAL} {ARG}{SER}{SER}{ASN}{ASN}{LEU}{GLY}{PRO}{VAL}{LEU} {PRO}{PRO}{THR}{ASN}{VAL}{GLY}{SER}{ASN}{THR}{TYR}-NH2 | | C-Terminal | NH2 |
|---|
| Description | Amylin is a 37-aa peptide produced in the pancreatic beta-cell secretory granules and Amylin is co-released with insulin. Amylin has specific binding sites in the CNS and Amylin may regulate gastric emptying and influence carbohydrate metabolism. |
|---|
| Solubility | Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. |
|---|
| Formula | C140H227N43O43 | | M.W. | 3200.6 | | Purity | > 95% | | Storage | Store at -20°C. Keep tightly closed. |
| * For Non-Clinical Research Use Only *
 |
1 |
Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
|
2 |
Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptideTM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
|
3 |
Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
|
4 |
Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.
|
Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.
|
|