GenScript Catalog Peptide: Adrenomedullin (AM) (1-52), human (RP11288)

Peptides&Biochemicals

You are here: Products » Peptides&Biochemicals » Catalog Peptides - Hot Products » Adrenomedullin (AM) (1-52), human

A B C D E F G H I J K L M N O P Q R S T U V W X Y Z ALL HotProducts

Adrenomedullin (AM) (1-52), human

Cat. No.

Size

Price

Figures

RP11288-0.5 mg

0.5 mg

$ 261.00

MSDS: 20080711222625 (PDF)
PROTOCOL: 20100407015038 (PDF)

References:

Marinoni E, et al. Immunohistochemical localization of adrenomedullin in fetal and neonatal lung. Pediatr. Res. Feb 1999; 45(2): 282-285.
Lewis LK, et al. Adrenomedullin(1-52) measured in human plasma by radioimmunoassay: plasma concentration, adsorption, and storage. Clin. Chem. Mar 1998; 44(3): 571-577.
Rademaker MT, et al. Beneficial hemodynamic and renal effects of adrenomedullin in an ovine model of heart failure. Circulation. Sep 1997; 96(6): 1983-1990.

Full Name

Adrenomedullin (AM) (1-52), human

Sequence
(one-letter code)

YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH₂

Sequence
(three-letter code)

{TYR}{ARG}{GLN}{SER}{MET}{ASN}{ASN}{PHE}{GLN}{GLY}
{LEU}{ARG}{SER}{PHE}{GLY}{CYS}{ARG}{PHE}{GLY}{THR}
{CYS}{THR}{VAL}{GLN}{LYS}{LEU}{ALA}{HIS}{GLN}{ILE}
{TYR}{GLN}{PHE}{THR}{ASP}{LYS}{ASP}{LYS}{ASP}{ASN}
{VAL}{ALA}{PRO}{ARG}{SER}{LYS}{ILE}{SER}{PRO}{GLN}
{GLY}{TYR}-NH₂

C-Terminal

NH₂

Chemical Bridge

Disulfide bridge: Cys¹⁶-Cys²¹

Description

Adrenomedullin (1-52) is a potent hypotensive peptide hormone with some structural similarity to calcitonin gene-related peptide. Adrenomedullin (1-52) has vasodilatory properties.

Solubility

The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.

Formula

C₂₆₄H₄₀₆N₈₀O₇₇S₃

M.W.

6028.9

Cas

148498-78-6

Purity

> 95%

Storage

Before use, store the peptide in the DRY form at 0-5�C. For best and most repeatable results, rehydrate the peptide immediately before use. Do not re-freeze any unused portions.

Notes

The peptide elicits a potent and long lasting hypotensive effect. Adrenomedullin (1-52), as supplied is intended for research use only, Do not use it to diagnose or treat any disease.

* For Non-Clinical Research Use Only *

Precast Gels

Code	Name	Size	Price
RP11291	peptide : Adrenomedullin (AM) (13-52), human	0.5 mg	$ 214.00
RP11293	peptide : Adrenomedullin (AM) (22-52), human	0.5 mg	$ 90.00
RP13758	peptide : Adrenomedullin (AM), canine	0.1 mg	$ 171.00
GN000629	ORF Clone : ADM	10 ug	$ 310.82
GN301905			$


1	Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
2	Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptide^TM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
3	Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (²H, ¹⁵N, and ¹³C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
4	Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.

Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.