| Cat. No. |
Size |
Price |
Figures |
|---|
RP11288-0.5 mg
| 0.5 mg | $ 261.25 | MSDS: 20080711222625 (PDF)
References:
- Marinoni E, et al. Immunohistochemical localization of adrenomedullin in fetal and neonatal lung. Pediatr. Res. Feb 1999; 45(2): 282-285.
- Lewis LK, et al. Adrenomedullin(1-52) measured in human plasma by radioimmunoassay: plasma concentration, adsorption, and storage. Clin. Chem. Mar 1998; 44(3): 571-577.
- Rademaker MT, et al. Beneficial hemodynamic and renal effects of adrenomedullin in an ovine model of heart failure. Circulation. Sep 1997; 96(6): 1983-1990.
|
|---|
| Full Name | | Adrenomedullin (AM) (1-52), human |
|
Sequence
(one-letter code) |
YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 |
Sequence
(three-letter code) | {TYR}{ARG}{GLN}{SER}{MET}{ASN}{ASN}{PHE}{GLN}{GLY}
{LEU}{ARG}{SER}{PHE}{GLY}{CYS}{ARG}{PHE}{GLY}{THR}
{CYS}{THR}{VAL}{GLN}{LYS}{LEU}{ALA}{HIS}{GLN}{ILE}
{TYR}{GLN}{PHE}{THR}{ASP}{LYS}{ASP}{LYS}{ASP}{ASN}
{VAL}{ALA}{PRO}{ARG}{SER}{LYS}{ILE}{SER}{PRO}{GLN}
{GLY}{TYR}-NH2 |
|---|
| C-Terminal | NH2 |
|---|
| Chemical Bridge | Disulfide bridge: Cys16-Cys21 |
|---|
| Description | Adrenomedullin (1-52) is a potent hypotensive peptide hormone with some structural similarity to calcitonin gene-related peptide. Adrenomedullin (1-52) has vasodilatory properties. |
|---|
| Solubility | The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. |
|---|
| Formula | C264H406N80O77S3 |
|---|
| M.W. | 6028.9 |
|---|
| Cas | 148498-78-6 |
|---|
| Purity | > 95% |
|---|
| Storage | Before use, store the peptide in the DRY form at 0-5°C. For best and most repeatable results, rehydrate the peptide immediately before use. Do not re-freeze any unused portions. |
| Notes | The peptide elicits a potent and long lasting hypotensive effect. Adrenomedullin (1-52), as supplied is intended for research use only, Do not use it to diagnose or treat any disease. |
|---|
