Home | My Account | Place Order | Contact | Overview
Home »  Products »  Peptide Products »  Peptide Catalog » Adrenomedullin (AM) (13-52), human
 
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence :(eg.NLGKHLNSMERVEWL)
(One letter code)
Search by Sequence :(eg.{GLU}{ILE}{GLN}{LEU}{MET})
(Three letter code)

 
Adrenomedullin (AM) (13-52), human

Cat. No. Size Price Figures
RP11291-0.5 mg
 		0.5 mg
$ 213.75
HPLC:  20060721145622  (PDF)
MS:  20060721145601  (PDF)


References:
  • Gumusel B, et al. Analysis of responses to adrenomedullin-(13-52) in the pulmonary vascular bed of rats. Am. J. Physiol. Apr 1998; 274(4 Pt 2): H1255-H1263.
  • Tam CW, et al. Enhanced vascular responses to adrenomedullin in mice overexpressing receptor-activity-modifying protein 2. Circ. Res. Feb 2006; 98(2): 262-70.
  • Hyman AL, et al. Novel catheterization technique for the in vivo measurement of pulmonary vascular responses in rats. Am. J. Physiol. Apr 1998; 274(4 Pt 2): H1218-H1229.
Full Name
Adrenomedullin (AM) (13-52), human
Sequence
(one-letter code)		 SFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
Sequence
(three-letter code)		{SER}{PHE}{GLY}{CYS}{ARG}{PHE}{GLY}{THR}{CYS}{THR}
{VAL}{GLN}{LYS}{LEU}{ALA}{HIS}{GLN}{ILE}{TYR}{GLN}
{PHE}{THR}{ASP}{LYS}{ASP}{LYS}{ASP}{ASN}{VAL}{ALA}
{PRO}{ARG}{SER}{LYS}{ILE}{SER}{PRO}{GLN}{GLY}{TYR}-NH2
C-TerminalNH2
Chemical BridgeDisulfide bridge: Cys16-Cys21
DescriptionAdrenomedullin (13-52) is a 40 amino acid peptide with one intramolecular disulfide bridge, Adrenomedullin (13-52) is a high affinity ligand for the adrenomedullin receptor.
FormulaC200H308N58O59S2
M.W.4533.2
Purity> 95%
StorageStore at -20°C.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP11288peptide : Adrenomedullin (AM) (1-52), human0.5 mg
$ 261.25
RP11293 peptide : Adrenomedullin (AM) (22-52), human0.5 mg
$ 90.25
RP13758peptide : Adrenomedullin (AM), canine0.1 mg
$ 171.00
GN000629 ORF Clone : ADM10 ug
$ 300.00
GN301905ORF Clone : ADM10 ug
$ 697.50



If you cannot find your peptides on our list, try our Express PeptideTM Service, and receive high-quality peptides in eight business days, guaranteed.

Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.