Peptide Products
You are here:  Products » Peptide Products » Catalog Peptides - Hot Products »  Adrenomedullin (AM) (22-52), human   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
Adrenomedullin (AM) (22-52), human

Cat. No. Size Price Figures
RP11293-0.5 mg
 		0.5 mg
$ 90.25
HPLC:  20050919140132  (PDF)
MASS SPECE:  20050919140154  (PDF)
MSDS:  20080711225849  (PDF)


References:
  • Champion HC, et al. Adrenomedullin-(22-52) antagonizes vasodilator responses to CGRP but not adrenomedullin in the cat. Am. J. Physiol. Jan 1997; 272(1 Pt 2): R234-R242.
  • Ross GR, Yallampalli C. Endothelium-Independent Relaxation by Adrenomedullin in Pregnant Rat Mesenteric Artery: Role of cAMP-Dependent Protein Kinase A and Calcium-Activated Potassium Channels. J. Pharmacol. Exp. Ther. Jun 2006; 317(3): 1269-1275.
  • Hashimoto H, et al. Centrally administered adrenomedullin 2 activates hypothalamic oxytocin-secreting neurons, causing elevated plasma oxytocin level in rats. Am. J. Physiol. Endocrinol. Metab. Nov 2005; 289(5): E753-E761.
Full Name
Adrenomedullin (AM) (22-52), human
Sequence
(one-letter code)		 TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
Sequence
(three-letter code)		{THR}{VAL}{GLN}{LYS}{LEU}{ALA}{HIS}{GLN}{ILE}{TYR}
{GLN}{PHE}{THR}{ASP}{LYS}{ASP}{LYS}{ASP}{ASN}{VAL}
{ALA}{PRO}{ARG}{SER}{LYS}{ILE}{SER}{PRO}{GLN}{GLY}
{TYR}-NH2
C-TerminalNH2
DescriptionAdrenomedullin (ADM) is a 52-aa hypotensive peptide. Adrenomedullin (ADM) has structural similarity with amylin. ADM is produced in peripheral tissues, adrenal medulla, lung, and kidney. ADM has specific receptors on astrocytes and it is unregulated in ischaemia.
SolubilitySoluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
FormulaC159H252N46O48
M.W.3576.1
Cas159899-65-7
Purity> 95%
StorageBefore using, store the peptide in the DRY form at 0 - 5°C. For best and repeatable results, rehydrate the peptide immediately before using. Do not re-freeze any unused portions.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP11288peptide : Adrenomedullin (AM) (1-52), human0.5 mg
$ 261.25
RP11291 peptide : Adrenomedullin (AM) (13-52), human0.5 mg
$ 213.75
RP13758peptide : Adrenomedullin (AM), canine0.1 mg
$ 171.00
GN000629 ORF Clone : ADM10 ug
$ 300.00
GN301905ORF Clone : ADM10 ug
$ 697.50



If you cannot find your peptides on our list, try our Express PeptideTM Service, and receive high-quality peptides in eight business days, guaranteed.

Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.