| |
Adrenomedullin (AM) (22-52), human  |
|
|

| Cat. No. |
Size |
Price |
Figures |
RP11293-0.5 mg
| 0.5 mg | $ 90.00 | HPLC: 20050919140132 (PDF) MASS SPECE: 20050919140154 (PDF) MSDS: 20080711225849 (PDF) PROTOCOL: 20100407015038 (PDF)
References:
- Champion HC, et al. Adrenomedullin-(22-52) antagonizes vasodilator responses to CGRP but not adrenomedullin in the cat. Am. J. Physiol. Jan 1997; 272(1 Pt 2): R234-R242.
- Ross GR, Yallampalli C. Endothelium-Independent Relaxation by Adrenomedullin in Pregnant Rat Mesenteric Artery: Role of cAMP-Dependent Protein Kinase A and Calcium-Activated Potassium Channels. J. Pharmacol. Exp. Ther. Jun 2006; 317(3): 1269-1275.
- Hashimoto H, et al. Centrally administered adrenomedullin 2 activates hypothalamic oxytocin-secreting neurons, causing elevated plasma oxytocin level in rats. Am. J. Physiol. Endocrinol. Metab. Nov 2005; 289(5): E753-E761.
|
|---|
| Full Name | | Adrenomedullin (AM) (22-52), human |
|
Sequence (one-letter code) |
TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 | Sequence (three-letter code) | {THR}{VAL}{GLN}{LYS}{LEU}{ALA}{HIS}{GLN}{ILE}{TYR} {GLN}{PHE}{THR}{ASP}{LYS}{ASP}{LYS}{ASP}{ASN}{VAL} {ALA}{PRO}{ARG}{SER}{LYS}{ILE}{SER}{PRO}{GLN}{GLY} {TYR}-NH2 | | C-Terminal | NH2 |
|---|
| Description | Adrenomedullin (ADM) is a 52-aa hypotensive peptide. Adrenomedullin (ADM) has structural similarity with amylin. ADM is produced in peripheral tissues, adrenal medulla, lung, and kidney. ADM has specific receptors on astrocytes and it is unregulated in ischaemia. |
|---|
| Solubility | Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. |
|---|
| Formula | C159H252N46O48 | | M.W. | 3576.1 | | Cas | 159899-65-7 |
|---|
| Purity | > 95% | | Storage | Before using, store the peptide in the DRY form at 0 - 5°C. For best and repeatable results, rehydrate the peptide immediately before using. Do not re-freeze any unused portions. |
| * For Non-Clinical Research Use Only *
 |
1 |
Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
|
2 |
Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptideTM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
|
3 |
Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
|
4 |
Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.
|
Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.
|
|