Peptide Products
You are here:  Products » Peptide Products » Catalog Peptides - Hot Products »  Adrenocorticotropic Hormone (ACTH) (1-39), human   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
Adrenocorticotropic Hormone (ACTH) (1-39), human

Cat. No. Size Price Figures
RP11304-0.5 mg
 		0.5 mg
$ 90.25
HPLC:  20060721145622  (PDF)
MS:  20060721145601  (PDF)
MSDS:  20080713225323  (PDF)


References:
  • Zhou R, et al. Adrenal hyperandrogenism is induced by fetal androgen excess in a rhesus monkey model of polycystic ovary syndrome. J.Clin.Endocrinol.Metab. Dec 2005; 90(12):6630-7.
  • Al-Majed HT, et al. ACTH stimulates insulin secretion from MIN6 cells and primary mouse and human islets of Langerhans. J.Endocrinol. Jan 2004; 180(1): 155-166.
  • Mallet C, et al. Differential expression of VEGF receptors in adrenal atrophy induced by dexamethasone: a protective role of ACTH. Am.J.Physiol.Endocrinol.Metab. Jan 2003; 284(1): E156-E167.
Full Name
Adrenocorticotropic Hormone (ACTH) (1-39), human
Alias Adrenocorticotropic hormone, human, Corticotropin
Sequence
(one-letter code)		 SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Sequence
(three-letter code)		{SER}{TYR}{SER}{MET}{GLU}{HIS}{PHE}{ARG}{TRP}{GLY}
{LYS}{PRO}{VAL}{GLY}{LYS}{LYS}{ARG}{ARG}{PRO}{VAL}
{LYS}{VAL}{TYR}{PRO}{ASN}{GLY}{ALA}{GLU}{ASP}{GLU}
{SER}{ALA}{GLU}{ALA}{PHE}{PRO}{LEU}{GLU}{PHE}
DescriptionAdrenocorticotropic hormones (ACTH). ACTH stimulates the adrenal cortex and the secretion of glucocorticoids such as cortisol. Another name for ACTH is corticotropin.
SolubilitySoluble in water (1 mg/ml), clear, colorless
FormulaC207H308N56O58S
M.W.4541.13
Cas12279-41-3
Purity> 95%
StorageStore the peptide at -20°C
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP11308peptide : Adrenocorticotropic Hormone (ACTH) (4-10), human5 mg
$ 57.00
RP11307 peptide : Adrenocorticotropic Hormone (ACTH) (18-39), human1 mg
$ 95.00
5 mg
$ 380.00
RP12907peptide : Adrenocorticotropic Hormone (ACTH) (1-4)5 mg
$ 57.00
RP11305 peptide : Adrenocorticotropic Hormone (ACTH) (1-39), rat0.5 mg
$ 90.25
RP11300peptide : Adrenocorticotropic Hormone (ACTH) (1-13), human0.5 mg
$ 28.50
RP11302 peptide : Adrenocorticotropic Hormone (ACTH) (1-17), human0.5 mg
$ 33.25
RP11301peptide : Adrenocorticotropic Hormone (ACTH) (1-16), human0.5 mg
$ 33.25
RP12908 peptide : Adrenocorticotropic Hormone (ACTH) (1-14)1 mg
$ 47.50
RP11303peptide : Adrenocorticotropic Hormone (ACTH) (1-24), human0.5 mg
$ 28.50
RP11299 peptide : Adrenocorticotropic Hormone (ACTH) (1-10), human5 mg
$ 57.00




Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.