| |
Adrenocorticotropic Hormone (ACTH) (1-39), rat  |
|
|
| Cat. No. |
Size |
Price |
Figures |
|---|
RP11305-0.5 mg
| 0.5 mg | $ 90.00 | MSDS: 20080713232945 (PDF)
HPLC: 20090805063258 (PDF)
MS: 20090805063320 (PDF)
References:
- Putnam CD, et al. Acute activation of the adrenocorticotropin-adrenal axis: effect on gonadotropin and prolactin secretion in the female rat. Endocrinology. May 1991; 128(5): 2558-2566.
- Eipper BA, Mains RE. Phosphorylation of pro-adrenocorticotropin/endorphin-derived peptides. J.Biol.Chem. May 1982; 257(9): 4907-4915.
|
|---|
| Full Name | | Adrenocorticotropic Hormone (ACTH) (1-39), rat |
|
| Alias |
Adrenocorticotropic hormone, rat, ACTH (1-39), rat |
Sequence
(one-letter code) |
SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF | Sequence
(three-letter code) | {SER}{TYR}{SER}{MET}{GLU}{HIS}{PHE}{ARG}{TRP}{GLY}
{LYS}{PRO}{VAL}{GLY}{LYS}{LYS}{ARG}{ARG}{PRO}{VAL}
{LYS}{VAL}{TYR}{PRO}{ASN}{VAL}{ALA}{GLU}{ASN}{GLU}
{SER}{ALA}{GLU}{ALA}{PHE}{PRO}{LEU}{GLU}{PHE} |
|---|
| Description | Peptide fragments of ACTH (1-39) were formed during in vitro incubation of the peptide with membrane preparations. ACTH (1-39) were isolated by high pressure liquid chromatography, and peptide fragments of ACTH (1-39) characterized by determination of amino acid composition and NH2- terminal residue. |
|---|
| Solubility | Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. |
|---|
| Formula | C210H315N57O57S1 |
|---|
| M.W. | 4582.5 |
|---|
| Cas | 77465-10-2 |
|---|
| Purity | > 95% |
|---|
| Storage | Before using, store the peptide in the DRY form at 0-5°C. For best and repeatable results, rehydrate the peptide immediately before using. Do not re-freeze any unused portions. |
| * For Non-Clinical Research Use Only *
 |
1 |
Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
|
2 |
Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptideTM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
|
3 |
Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
|
4 |
Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.
|
Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.
|
|
