You are here:  Products » Peptide Products » Catalog Peptides - Hot Products »  Adrenocorticotropic Hormone (ACTH) (1-39), rat   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
Adrenocorticotropic Hormone (ACTH) (1-39), rat

Cat. No. Size Price Figures
RP11305-0.5 mg
0.5 mg
$ 90.00
MSDS:  20080713232945  (PDF)
HPLC:  20090805063258  (PDF)
MS:  20090805063320  (PDF)


References:
  • Putnam CD, et al. Acute activation of the adrenocorticotropin-adrenal axis: effect on gonadotropin and prolactin secretion in the female rat. Endocrinology. May 1991; 128(5): 2558-2566.
  • Eipper BA, Mains RE. Phosphorylation of pro-adrenocorticotropin/endorphin-derived peptides. J.Biol.Chem. May 1982; 257(9): 4907-4915.
Full Name
Adrenocorticotropic Hormone (ACTH) (1-39), rat
Alias Adrenocorticotropic hormone, rat, ACTH (1-39), rat
Sequence
(one-letter code)
SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF
Sequence
(three-letter code)
{SER}{TYR}{SER}{MET}{GLU}{HIS}{PHE}{ARG}{TRP}{GLY}
{LYS}{PRO}{VAL}{GLY}{LYS}{LYS}{ARG}{ARG}{PRO}{VAL}
{LYS}{VAL}{TYR}{PRO}{ASN}{VAL}{ALA}{GLU}{ASN}{GLU}
{SER}{ALA}{GLU}{ALA}{PHE}{PRO}{LEU}{GLU}{PHE}
DescriptionPeptide fragments of ACTH (1-39) were formed during in vitro incubation of the peptide with membrane preparations. ACTH (1-39) were isolated by high pressure liquid chromatography, and peptide fragments of ACTH (1-39) characterized by determination of amino acid composition and NH2- terminal residue.
SolubilitySoluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
FormulaC210H315N57O57S1
M.W.4582.5
Cas77465-10-2
Purity> 95%
StorageBefore using, store the peptide in the DRY form at 0-5°C. For best and repeatable results, rehydrate the peptide immediately before using. Do not re-freeze any unused portions.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
GN073986ORF Clone : Pomc10 ug
$ 885.00
GN138783 ORF Clone : Pomc210 ug
$ 885.00




1
Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
2
Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptideTM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
3
Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
4
Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.




Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.