Peptides&Biochemicals
You are here:  Products » Peptides&Biochemicals » Catalog Peptides - Hot Products »  β-Endorphin, camel   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
β-Endorphin, camel

Cat. No. Size Price Figures
RP11343-1 mg
 		1 mg
$ 109.00
MS:  20060721145602  (PDF)
HPLC:  20060721145622  (PDF)
MSDS:  20080714232113  (PDF)
PROTOCOL:  20100407015038  (PDF)

STRUCTURE:
b-Endorphin Structure
Zoom

References:
  • Tseng LF, et al. Differential antinociceptive effects of endomorphin-1 and endomorphin-2 in the mouse. J. Pharmacol. Exp. Ther. Feb 2000; 292(2): 576-583.
  • Law PY, Loh HH. Regulation of opioid receptor activities. J. Pharmacol. Exp. Ther. May 1999; 289(2): 607-624.
  • Cui M, et al. Periaqueductal gray stimulation-induced inhibition of nociceptive dorsal horn neurons in rats is associated with the release of norepinephrine, serotonin, and amino acids. J. Pharmacol. Exp. Ther. May 1999; 289(2): 868-876.
Full Name
β-Endorphin, camel
Alias beta endorphin
Sequence
(one-letter code)		 YGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQ
Sequence
(three-letter code)		{TYR}{GLY}{GLY}{PHE}{MET}{THR}{SER}{GLU}{LYS}{SER}
{GLN}{THR}{PRO}{LEU}{VAL}{THR}{LEU}{PHE}{LYS}{ASN}
{ALA}{ILE}{ILE}{LYS}{ASN}{ALA}{HIS}{LYS}{LYS}{GLY}
{GLN}
DescriptionPotent endogenous opioid protein b-Endorphin is derived from propiomelanocortin, β-Endorphin is a protein found in the brain, anterior pituitary, skin, immune system, and other peripheral sites. β-endorphin is released in response to painful stimuli. β-endorphin has potent antinociceptive activity that is mediated through its action on μ receptors in brain and by μ and κ receptors in the spinal cord.
SolubilityThe peptide is insoluble in water. Dissolve the peptide in small amount of acetonitrile and then dilute the solution with water or any other buffer.
FormulaC155H250N42O44S1
M.W.3438
Cas59887-17-1
Purity> 95%
StorageStore the peptide at -20°C
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP11344peptide : β-Endorphin, human1 mg
$ 71.00
RP11346 peptide : β-Endorphin, rat1 mg
$ 119.00
GN049052
$
GN073986 ORF Clone : Pomc10 ug
$ 354.32
GN138783ORF Clone : Pomc210 ug
$ 354.32
GN153997
$




1
 Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
2
 Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptideTM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
3
 Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
4
 Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.




Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.