| |
β-Endorphin, camel  |
|
|

| Cat. No. |
Size |
Price |
Figures |
RP11343-1 mg
| 1 mg | $ 109.00 | MS: 20060721145602 (PDF) HPLC: 20060721145622 (PDF) MSDS: 20080714232113 (PDF) PROTOCOL: 20100407015038 (PDF) STRUCTURE:
 Zoom
References:
- Tseng LF, et al. Differential antinociceptive effects of endomorphin-1 and endomorphin-2 in the mouse. J. Pharmacol. Exp. Ther. Feb 2000; 292(2): 576-583.
- Law PY, Loh HH. Regulation of opioid receptor activities. J. Pharmacol. Exp. Ther. May 1999; 289(2): 607-624.
- Cui M, et al. Periaqueductal gray stimulation-induced inhibition of nociceptive dorsal horn neurons in rats is associated with the release of norepinephrine, serotonin, and amino acids. J. Pharmacol. Exp. Ther. May 1999; 289(2): 868-876.
|
|---|
| Full Name | |
| Alias |
beta endorphin |
Sequence (one-letter code) |
YGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQ | Sequence (three-letter code) | {TYR}{GLY}{GLY}{PHE}{MET}{THR}{SER}{GLU}{LYS}{SER} {GLN}{THR}{PRO}{LEU}{VAL}{THR}{LEU}{PHE}{LYS}{ASN} {ALA}{ILE}{ILE}{LYS}{ASN}{ALA}{HIS}{LYS}{LYS}{GLY} {GLN} | | Description | Potent endogenous opioid protein b-Endorphin is derived from propiomelanocortin, β-Endorphin is a protein found in the brain, anterior pituitary, skin, immune system, and other peripheral sites. β-endorphin is released in response to painful stimuli. β-endorphin has potent antinociceptive activity that is mediated through its action on μ receptors in brain and by μ and κ receptors in the spinal cord. |
|---|
| Solubility | The peptide is insoluble in water. Dissolve the peptide in small amount of acetonitrile and then dilute the solution with water or any other buffer. |
|---|
| Formula | C155H250N42O44S1 | | M.W. | 3438 | | Cas | 59887-17-1 |
|---|
| Purity | > 95% | | Storage | Store the peptide at -20°C |
| * For Non-Clinical Research Use Only *
 |
1 |
Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
|
2 |
Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptideTM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
|
3 |
Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
|
4 |
Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.
|
Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.
|
|