| |
β-Endorphin, camel  |
|
|
| Cat. No. |
Size |
Price |
Figures |
|---|
RP11343-1 mg
| 1 mg | $ 109.25 | HPLC: 20060721145622 (PDF)
MS: 20060721145602 (PDF)
MSDS: 20080714232113 (PDF)
STRUCTURE:
Zoom
References:
- Tseng LF, et al. Differential antinociceptive effects of endomorphin-1 and endomorphin-2 in the mouse. J. Pharmacol. Exp. Ther. Feb 2000; 292(2): 576-583.
- Law PY, Loh HH. Regulation of opioid receptor activities. J. Pharmacol. Exp. Ther. May 1999; 289(2): 607-624.
- Cui M, et al. Periaqueductal gray stimulation-induced inhibition of nociceptive dorsal horn neurons in rats is associated with the release of norepinephrine, serotonin, and amino acids. J. Pharmacol. Exp. Ther. May 1999; 289(2): 868-876.
|
|---|
| Full Name | |
| Alias |
beta endorphin |
Sequence
(one-letter code) |
YGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQ | Sequence
(three-letter code) | {TYR}{GLY}{GLY}{PHE}{MET}{THR}{SER}{GLU}{LYS}{SER}
{GLN}{THR}{PRO}{LEU}{VAL}{THR}{LEU}{PHE}{LYS}{ASN}
{ALA}{ILE}{ILE}{LYS}{ASN}{ALA}{HIS}{LYS}{LYS}{GLY}
{GLN} |
|---|
| Description | Potent endogenous opioid protein b-Endorphin is derived from propiomelanocortin, β-Endorphin is a protein found in the brain, anterior pituitary, skin, immune system, and other peripheral sites. β-endorphin is released in response to painful stimuli. β-endorphin has potent antinociceptive activity that is mediated through its action on μ receptors in brain and by μ and κ receptors in the spinal cord. |
|---|
| Solubility | The peptide is insoluble in water. Dissolve the peptide in small amount of acetonitrile and then dilute the solution with water or any other buffer. |
|---|
| Formula | C155H250N42O44S1 |
|---|
| M.W. | 3438 |
|---|
| Cas | 59887-17-1 |
|---|
| Purity | > 95% |
|---|
| Storage | Store the peptide at -20°C |
| * For Non-Clinical Research Use Only *
Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.
|
|
