You are here:  Products » Peptide Products » Catalog Peptides - Hot Products »  β-Endorphin, human   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
β-Endorphin, human

Cat. No. Size Price Figures
RP11344-1 mg
1 mg
$ 71.00
MSDS:  20080715053338  (PDF)


References:
  • Kauser S, et al. Modulation of the human hair follicle pigmentary unit by corticotropin-releasing hormone and urocortin peptides. FASEB J. May 2006; 20(7): 882-895.
  • Kauser S, et al. A fully functional proopiomelanocortin/melanocortin-1 receptor system regulates the differentiation of human scalp hair follicle melanocytes. Endocrinology. Feb 2005; 146(2): 532-543.
  • Bohm M, et al. Detection of functionally active melanocortin receptors and evidence for an immunoregulatory activity of alpha-melanocyte-stimulating hormone in human dermal papilla cells. Endocrinology. Nov 2005; 146(11): 4635-4646.
Full Name
β-Endorphin, human
Sequence
(one-letter code)
YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
Sequence
(three-letter code)
{TYR}{GLY}{GLY}{PHE}{MET}{THR}{SER}{GLU}{LYS}{SER}
{GLN}{THR}{PRO}{LEU}{VAL}{THR}{LEU}{PHE}{LYS}{ASN}
{ALA}{ILE}{ILE}{LYS}{ASN}{ALA}{TYR}{LYS}{LYS}{GLY}
{GLU}
DescriptionPotent endogenous opioid protein b-Endorphin is derived from propiomelanocortin, b-Endorphin is a protein found in the brain, anterior pituitary, skin, immune system, and other peripheral sites. β-Endorphin is released in response to painful stimuli and b-Endorphin has potent antinociceptive activity mediated through its action on μ receptors in brain and by μ and κ receptors in the spinal cord.
SolubilityThe peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
FormulaC158H251N39O46S1
M.W.3465.1
Cas61214-51-5
Purity> 95%
StorageStore the peptide at -20°C
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP11343peptide : β-Endorphin, camel1 mg
$ 109.00
RP11346 peptide : β-Endorphin, rat1 mg
$ 119.00
GN013027ORF Clone : POMC10 ug
$ 1005.00
GN040955 ORF Clone : POMC10 ug
$ 1005.00
GN308539ORF Clone : POMC10 ug
$ 1009.00




1
Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
2
Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptideTM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
3
Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
4
Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.




Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.