| |
β-Endorphin, rat  |
|
|
| Cat. No. |
Size |
Price |
Figures |
|---|
RP11346-1 mg
| 1 mg | $ 118.75 | MSDS: 20080715212924 (PDF)
References:
- Cheng JT, et al. Novel mechanism for plasma glucose-lowering action of metformin in streptozotocin-induced diabetic rats. Diabetes. Mar 2006; 55(3): 819-825.
- Zhou Yi Syuu W, et al. Modulation of cardiovascular excitatory responses in rats by transcutaneous magnetic stimulation: role of the spinal cord. J Appl Physiol. Mar 2006; 100(3): 926-932.
- Levin BE, et al. F-DIO obesity-prone rat is insulin resistant before obesity onset. Am. J. Physiol. Regul. Integr. Comp. Physiol. Sep 2005; 289(3): R704-711.
|
|---|
| Full Name | |
| Alias |
β-Endorphin, rat |
Sequence
(one-letter code) |
YGGFMTSEKSQTPLVTLFKNAIIKNVHKKGQ | Sequence
(three-letter code) | {TYR}{GLY}{GLY}{PHE}{MET}{THR}{SER}{GLU}{LYS}{SER}
{GLN}{THR}{PRO}{LEU}{VAL}{THR}{LEU}{PHE}{LYS}{ASN}
{ALA}{ILE}{ILE}{LYS}{ASN}{VAL}{HIS}{LYS}{LYS}{GLY}
{GLN} |
|---|
| Description | Potent endogenous opioid protein that is derived from propiomelanocortin, a protein found in the brain, anterior pituitary, skin, immune system, and other peripheral sites. It is released in response to painful stimuli and has potent antinociceptive activity that is mediated through its action on µ receptors in brain and by µ and κ receptors in the spinal cord. |
|---|
| Solubility | Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. |
|---|
| Formula | C157H254N42O44S1 |
|---|
| M.W. | 3466.1 |
|---|
| Cas | 77367-63-6 |
|---|
| Purity | > 95% |
|---|
| Storage | Store at -20°C. |
| * For Non-Clinical Research Use Only *
Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.
|
|
