| |
β-Endorphin, rat  |
|
|
| Cat. No. |
Size |
Price |
Figures |
|---|
RP11346-1 mg
| 1 mg | $ 119.00 | MSDS: 20080715212924 (PDF)
References:
- Cheng JT, et al. Novel mechanism for plasma glucose-lowering action of metformin in streptozotocin-induced diabetic rats. Diabetes. Mar 2006; 55(3): 819-825.
- Zhou Yi Syuu W, et al. Modulation of cardiovascular excitatory responses in rats by transcutaneous magnetic stimulation: role of the spinal cord. J Appl Physiol. Mar 2006; 100(3): 926-932.
- Levin BE, et al. F-DIO obesity-prone rat is insulin resistant before obesity onset. Am. J. Physiol. Regul. Integr. Comp. Physiol. Sep 2005; 289(3): R704-711.
|
|---|
| Full Name | |
| Alias |
β-Endorphin, rat |
Sequence
(one-letter code) |
YGGFMTSEKSQTPLVTLFKNAIIKNVHKKGQ | Sequence
(three-letter code) | {TYR}{GLY}{GLY}{PHE}{MET}{THR}{SER}{GLU}{LYS}{SER}
{GLN}{THR}{PRO}{LEU}{VAL}{THR}{LEU}{PHE}{LYS}{ASN}
{ALA}{ILE}{ILE}{LYS}{ASN}{VAL}{HIS}{LYS}{LYS}{GLY}
{GLN} |
|---|
| Description | Potent endogenous opioid protein that is derived from propiomelanocortin, a protein found in the brain, anterior pituitary, skin, immune system, and other peripheral sites. It is released in response to painful stimuli and has potent antinociceptive activity that is mediated through its action on µ receptors in brain and by µ and κ receptors in the spinal cord. |
|---|
| Solubility | Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. |
|---|
| Formula | C157H254N42O44S1 |
|---|
| M.W. | 3466.1 |
|---|
| Cas | 77367-63-6 |
|---|
| Purity | > 95% |
|---|
| Storage | Store at -20°C. |
| * For Non-Clinical Research Use Only *
 |
1 |
Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
|
2 |
Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptideTM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
|
3 |
Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
|
4 |
Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.
|
Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.
|
|
