| Cat. No. |
Size |
Price |
Figures |
|---|
RP11861-0.5 mg
| 0.5 mg | $ 190.00 | MSDS: 20080715215200 (PDF)
References:
- Seal LJ, et al. Prolactin releasing peptide (PrRP) stimulates luteinizing hormone (LH) and follicle stimulating hormone (FSH) via a hypothalamic mechanism in male rats. Endocrinology. May 2000; 141(5): 1909-1192.
- Ozawa A, et al. Transcriptional regulation of the human PRL-releasing peptide (PrRP) receptor gene by a dopamine 2 Receptor agonist: cloning and characterization of the human PrRP receptor gene and its promoter region. Mol. Endocrinol. Apr 2002; 16(4): 785-798.
|
|---|
RP11861-5 mg
| 5 mg | $ 912.00 |
|---|
| Full Name | | Prolactin Releasing Peptide (1-31), human |
|
| Alias |
PrRP |
Sequence
(one-letter code) |
SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2 |
Sequence
(three-letter code) | {SER}{ARG}{THR}{HIS}{ARG}{HIS}{SER}{MET}{GLU}{ILE}
{ARG}{THR}{PRO}{ASP}{ILE}{ASN}{PRO}{ALA}{TRP}{TYR}
{ALA}{SER}{ARG}{GLY}{ILE}{ARG}{PRO}{VAL}{GLY}{ARG}
{PHE}-NH2 |
|---|
| C-Terminal | NH2 |
|---|
| Description | GenScript Prolactin-releasing peptide is a specific prolactin releasing peptide. GenScript prolactin-releasing peptide (PrRP) was originally isolated as an endogenous hypothalamic ligand for the hGR3 orphan receptor and has been shown to release prolactin from dispersed pituitaries harvested from lactating female rats and only at very high doses in cycling females. PrRPs have no effect on prolactin production from dispersed pituitary cells harvested from males. |
|---|
| Solubility | Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents. |
|---|
| Formula | C160H252N56O42S1 |
|---|
| M.W. | 3664.15 |
|---|
| Purity | > 95% |
|---|
| Storage | Store the peptide at -20°C. Keep container tightly closed. Store in a cool dry place. |
