| |
[Thr 1-Ala 2-Pro 3-Arg 4]-Atrial Natriuretic Peptide (ANP) (Urodilatin), human  |
|
|

| Cat. No. |
Size |
Price |
Figures |
RP11926-0.5 mg
| 0.5 mg | $ 114.00 | MSDS: 20080715224659 (PDF) PROTOCOL: 20100407015038 (PDF) STRUCTURE:
 Zoom
References:
- Carstens J, et al. Renal effects of a urodilatin infusion in patients with liver cirrhosis, with and without ascites. J. Am. Soc. Nephrol. Aug 1998; 9(8): 1489-1498.
- Schermuly RT, et al. Urodilatin, a natriuretic peptide stimulating particulate guanylate cyclase, and the phosphodiesterase 5 inhibitor dipyridamole attenuate experimental pulmonary hypertension: synergism upon coapplication. Am. J. Respir. Cell Mol. Biol. Aug 2001; 25(2): 219-225.
- Chen HH, et al. Equimolar doses of atrial and brain natriuretic peptides and urodilatin have differential renal actions in overt experimental heart failure. Am. J. Physiol. Regul. Integr. Comp. Physiol. May 2005; 288(5): R1093-R1097.
|
|---|
| Full Name | | [Thr1-Ala2-Pro3-Arg4]-Atrial Natriuretic Peptide (ANP) (Urodilatin), human |
|
| Alias |
[T1-A2-P3-R4]-ANP (Urodilatin), human, TAPR-Atrial Natriuretic Peptide; Urodilatin; URO |
Sequence (one-letter code) |
TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 11-27) | Sequence (three-letter code) | {THR}{ALA}{PRO}{ARG}{SER}{LEU}{ARG}{ARG}{SER}{SER} {CYS}{PHE}{GLY}{GLY}{ARG}{MET}{ASP}{ARG}{ILE}{GLY} {ALA}{GLN}{SER}{GLY}{LEU}{GLY}{CYS}{ASN}{SER}{PHE} {ARG}{TYR} | | Chemical Bridge | 11-27 |
|---|
| Description | Urodilatin is a natriuretic factor that is produced in the kidney and secreted into the urine. Urodilatin is found to regulate water and sodium reabsorption in the collecting duct and it is also known to relieve patients' symptoms in decompensated CHF by improving the hemodynamic state.
|
|---|
| Solubility | The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents. |
|---|
| Formula | C145H234N52O44S3 | | M.W. | 3506 | | Cas | 115966-23-9 |
|---|
| Purity | > 95% | | Storage | Store the peptide at -20°C. Keep container tightly closed. | | Notes | (CDD = Cardiodilatin; CDD/ANP (99-126) = ANP). potent vasorelaxant |
| * For Non-Clinical Research Use Only *
 |
1 |
Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
|
2 |
Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptideTM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
|
3 |
Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
|
4 |
Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.
|
Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.
|
|