| Cat. No. |
Size |
Price |
Figures |
|---|
RP11926-0.5 mg
| 0.5 mg | $ 114.00 | MSDS: 20080715224659 (PDF)
STRUCTURE:
Zoom
References:
- Carstens J, et al. Renal effects of a urodilatin infusion in patients with liver cirrhosis, with and without ascites. J. Am. Soc. Nephrol. Aug 1998; 9(8): 1489-1498.
- Schermuly RT, et al. Urodilatin, a natriuretic peptide stimulating particulate guanylate cyclase, and the phosphodiesterase 5 inhibitor dipyridamole attenuate experimental pulmonary hypertension: synergism upon coapplication. Am. J. Respir. Cell Mol. Biol. Aug 2001; 25(2): 219-225.
- Chen HH, et al. Equimolar doses of atrial and brain natriuretic peptides and urodilatin have differential renal actions in overt experimental heart failure. Am. J. Physiol. Regul. Integr. Comp. Physiol. May 2005; 288(5): R1093-R1097.
|
|---|
| Full Name | | [Thr1-Ala2-Pro3-Arg4]-Atrial Natriuretic Peptide (ANP) (Urodilatin), human |
|
| Alias |
TAPR-Atrial Natriuretic Peptide; Urodilatin; URO |
Sequence
(one-letter code) |
TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 11-27) |
Sequence
(three-letter code) | {THR}{ALA}{PRO}{ARG}{SER}{LEU}{ARG}{ARG}{SER}{SER}
{CYS}{PHE}{GLY}{GLY}{ARG}{MET}{ASP}{ARG}{ILE}{GLY}
{ALA}{GLN}{SER}{GLY}{LEU}{GLY}{CYS}{ASN}{SER}{PHE}
{ARG}{TYR} |
|---|
| Chemical Bridge | 11-27 |
|---|
| Description | Urodilatin is a natriuretic factor that is produced in the kidney and secreted into the urine. Urodilatin is found to regulate water and sodium reabsorption in the collecting duct, and it is also known to relieve patients' symptoms in decompensated CHF by improving the hemodynamic state.
|
|---|
| Solubility | The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents. |
|---|
| Formula | C145H234N52O44S3 |
|---|
| M.W. | 3506 |
|---|
| Cas | 115966-23-9 |
|---|
| Purity | > 95% |
|---|
| Storage | Store the peptide at -20°C. Keep container tightly closed. |
| Notes | (CDD = Cardiodilatin; CDD/ANP (99-126) = ANP). potent vasorelaxant |
|---|
