You are here:  Products » Peptide Products » Catalog Peptides - Hot Products »  Glucagon-Like Peptide (GLP) I (7-37)   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
Glucagon-Like Peptide (GLP) I (7-37)

Cat. No. Size Price Figures
RP12738-0.5 mg
0.5 mg
$ 118.75
HPLC:  20060721145623  (PDF)
MS:  20060721145603  (PDF)
MSDS:  20080716051328  (PDF)

EXAMPLE:
GLP-1 Structure
Zoom

References:
  • Cottrell JJ, et al. Glucagon-like peptide-2 protects against TPN-induced intestinal hexose malabsorption in enterally refed piglets. Am. J. Physiol Gastrointest Liver Physiol. Feb 2006; 290(2): G293-G300.
  • Stephens J, et al. Glucagon-like peptide-2 acutely increases proximal small intestinal blood flow in TPN-fed neonatal piglets. Am. J. Physiol. Regul. Integr. Comp. Physiol. Feb 2006; 290(2): R283-R289.
  • Schirra J, et al. Endogenous glucagon-like peptide 1 controls endocrine pancreatic secretion and antro-pyloro-duodenal motility in humans. Gut. Feb 2006; 55(2): 243-251.
Full Name
Glucagon-Like Peptide (GLP) I (7-37)
Alias Glucagon-Like PeptideI; Glucagon-Like Peptide 1; Glucagon-Like Peptide1; GLP-I; GLPI; GLP-1; GLP1; GCG peptide
Sequence
(one-letter code)
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Sequence
(three-letter code)
{HIS}{ALA}{GLU}{GLY}{THR}{PHE}{THR}{SER}{ASP}{VAL}
{SER}{SER}{TYR}{LEU}{GLU}{GLY}{GLN}{ALA}{ALA}{LYS}
{GLU}{PHE}{ILE}{ALA}{TRP}{LEU}{VAL}{LYS}{GLY}{ARG}
{GLY}
DescriptionGLP-1 (7-37) is a truncated, bioactive form of GLP-1 that is the product of proglucagon processing in intestinal endocrine L cells. It is a potent insulinotropic hormone.
SolubilitySoluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
FormulaC151H228N40O47
M.W.3355.68
Purity> 95%
StorageStore at -20°C. Keep tightly closed. Store in a cool dry place.
NotesPotent Insulin secretagogue.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP10769peptide : Glucagon-Like Peptide (GLP) II, human0.5 mg
$ 90.25
RP10774 peptide : Glucagon-Like Peptide (GLP) II-Arg, human0.5 mg
$ 109.25
RP10775peptide : Glucagon-Like Peptide (GLP) II, rat0.5 mg
$ 137.75
Z00212 protein : Glucagon-Like Peptide (GLP)-1, human10 ug
$ 70.00
50 ug
$ 180.00
GN006652ORF Clone : GCG10 ug
$ 678.75
GN044047 ORF Clone : GCG10 ug
$ 678.75
GN073236ORF Clone : Gcg10 ug
$ 678.75
GN077067 ORF Clone : Gcg10 ug
$ 678.75
GN153764ORF Clone : GCG10 ug
$ 678.75
GN186944 ORF Clone : GCG10 ug
$ 678.75



If you cannot find your peptides on our list, try our Express PeptideTM Service, and receive high-quality peptides in eight business days, guaranteed.

Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.