| Cat. No. |
Size |
Price |
Figures |
|---|
RP12738-0.5 mg
| 0.5 mg | $ 118.75 | HPLC: 20060721145623 (PDF)
MS: 20060721145603 (PDF)
MSDS: 20080716051328 (PDF)
EXAMPLE:
Zoom
References:
- Cottrell JJ, et al. Glucagon-like peptide-2 protects against TPN-induced intestinal hexose malabsorption in enterally refed piglets. Am. J. Physiol Gastrointest Liver Physiol. Feb 2006; 290(2): G293-G300.
- Stephens J, et al. Glucagon-like peptide-2 acutely increases proximal small intestinal blood flow in TPN-fed neonatal piglets. Am. J. Physiol. Regul. Integr. Comp. Physiol. Feb 2006; 290(2): R283-R289.
- Schirra J, et al. Endogenous glucagon-like peptide 1 controls endocrine pancreatic secretion and antro-pyloro-duodenal motility in humans. Gut. Feb 2006; 55(2): 243-251.
|
|---|
| Full Name | | Glucagon-Like Peptide (GLP) I (7-37) |
|
| Alias |
Glucagon-Like PeptideI; Glucagon-Like Peptide 1; Glucagon-Like Peptide1; GLP-I; GLPI; GLP-1; GLP1; GCG peptide |
Sequence
(one-letter code) |
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
Sequence
(three-letter code) | {HIS}{ALA}{GLU}{GLY}{THR}{PHE}{THR}{SER}{ASP}{VAL}
{SER}{SER}{TYR}{LEU}{GLU}{GLY}{GLN}{ALA}{ALA}{LYS}
{GLU}{PHE}{ILE}{ALA}{TRP}{LEU}{VAL}{LYS}{GLY}{ARG}
{GLY} |
|---|
| Description | GLP-1 (7-37) is a truncated, bioactive form of GLP-1 that is the product of proglucagon processing in intestinal endocrine L cells. It is a potent insulinotropic hormone. |
|---|
| Solubility | Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. |
|---|
| Formula | C151H228N40O47 |
|---|
| M.W. | 3355.68 |
|---|
| Purity | > 95% |
|---|
| Storage | Store at -20°C. Keep tightly closed. Store in a cool dry place. |
| Notes | Potent Insulin secretagogue. |
|---|
