You are here:  Products » Peptides&Biochemicals » Catalog Peptides - Hot Products »  Glucagon-Like Peptide (GLP) I (7-37)   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
Glucagon-Like Peptide (GLP) I (7-37)

Cat. No. Size Price Figures
RP12738-0.5 mg
0.5 mg
$ 119.00
MS:  20060721145603  (PDF)
HPLC:  20060721145623  (PDF)
MSDS:  20080716051328  (PDF)
PROTOCOL:  20100407015038  (PDF)

EXAMPLE:
GLP-1 Structure
Zoom

References:
  • Cottrell JJ, et al. Glucagon-like peptide-2 protects against TPN-induced intestinal hexose malabsorption in enterally refed piglets. Am. J. Physiol Gastrointest Liver Physiol. Feb 2006; 290(2): G293-G300.
  • Stephens J, et al. Glucagon-like peptide-2 acutely increases proximal small intestinal blood flow in TPN-fed neonatal piglets. Am. J. Physiol. Regul. Integr. Comp. Physiol. Feb 2006; 290(2): R283-R289.
  • Schirra J, et al. Endogenous glucagon-like peptide 1 controls endocrine pancreatic secretion and antro-pyloro-duodenal motility in humans. Gut. Feb 2006; 55(2): 243-251.
Full Name
Glucagon-Like Peptide (GLP) I (7-37)
Alias Glucagon-Like PeptideI; Glucagon-Like Peptide 1; Glucagon-Like Peptide1; GLP-I; GLPI; GLP-1; GLP1; GCG peptide
Sequence
(one-letter code)
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Sequence
(three-letter code)
{HIS}{ALA}{GLU}{GLY}{THR}{PHE}{THR}{SER}{ASP}{VAL}
{SER}{SER}{TYR}{LEU}{GLU}{GLY}{GLN}{ALA}{ALA}{LYS}
{GLU}{PHE}{ILE}{ALA}{TRP}{LEU}{VAL}{LYS}{GLY}{ARG}
{GLY}
DescriptionGLP-1 (7-37) is a truncated, bioactive form of GLP-1 that is the product of proglucagon processing in intestinal endocrine L cells. It is a potent insulinotropic hormone.
SolubilitySoluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
FormulaC151H228N40O47
M.W.3355.68
Purity> 95%
StorageStore at -20°C. Keep tightly closed. Store in a cool dry place.
NotesPotent Insulin secretagogue.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP10769peptide : Glucagon-Like Peptide (GLP) II, human0.5 mg
$ 90.00
RP10774 peptide : Glucagon-Like Peptide (GLP) II-Arg, human0.5 mg
$ 109.00
RP10775peptide : Glucagon-Like Peptide (GLP) II, rat0.5 mg
$ 138.00
Z00212 protein : Glucagon-Like Peptide-1 (GLP-1), human10 ug
$ 70.00
GN006652ORF Clone : GCG10 ug
$ 308.00
GN044047 ORF Clone : GCG10 ug
$ 360.77
GN073236ORF Clone : Gcg10 ug
$ 308.00
GN077067 ORF Clone : Gcg10 ug
$ 308.00
GN153764ORF Clone : GCG10 ug
$ 360.77
GN186944 ORF Clone : GCG10 ug
$ 360.77




1
Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
2
Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptideTM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
3
Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
4
Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.




Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.