A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
Calcitonin, eel

Cat. No. Size Price Figures
RP12786-1 mg
1 mg
$ 109.00
MS:  20060721145603  (PDF)
HPLC:  20060721145623  (PDF)
MSDS:  20080703041953  (PDF)
PROTOCOL:  20100407015038  (PDF)

STRUCTURE:
Calcitonin structure
Zoom

References:
  • Supowit SC, et al. Calcitonin gene-related peptide protects against hypertension-induced heart and kidney damage. Hypertension. Jan 2005; 45(1): 109-114.
  • Barbet J, et al. Prognostic impact of serum calcitonin and carcinoembryonic antigen doubling-times in patients with medullary thyroid carcinoma. J. Clin. Endocrinol. Metab. Nov 2005; 90(11): 6077-6084.
  • Bowers MC, et al. Role of calcitonin gene-related peptide in hypertension-induced renal damage. Hypertension. Jul 2005; 46(1): 51-57.
RP12786-5 mg
5 mg
$ 451.00
Full Name
Calcitonin, eel
Sequence
(one-letter code)
CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2
Sequence
(three-letter code)
{CYS}{SER}{ASN}{LEU}{SER}{THR}{CYS}{VAL}{LEU}{GLY}
{LYS}{LEU}{SER}{GLN}{GLU}{LEU}{HIS}{LYS}{LEU}{GLN}
{THR}{TYR}{PRO}{ARG}{THR}{ASP}{VAL}{GLY}{ALA}{GLY}
{THR}{PRO}-NH2
C-TerminalNH2
Chemical BridgeDisulfide bridge: Cys1-Cys7
DescriptionCalcitonin is hypocalcemic hormone produced by the parafollicular C cells of the thyroid or by the ultimobranchial bodies of nonmammalian vertebrates. Calcitonin decreases blood calcium and phosphate due to inhibition of resorption by osteoblasts and osteocytes.
FormulaC146H241N43O47S2
M.W.3414.9
Cas57014-02-5
Purity> 95%
StorageStore at -20°C. Keep tightly closed. Store in a cool dry place.
NotesCalcitonin is A 32 amino acid polypeptide, 8 of which are conserved across all species.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP11096peptide : Calcitonin, chicken0.5 mg
$ 71.00
RP11098 peptide : Calcitonin, rat0.5 mg
$ 71.00
RP11099peptide : Calcitonin, salmon0.5 mg
$ 57.00
RP11089 peptide : Calcitonin Gene Related Peptide (CGRP) (8-37), human0.5 mg
$ 90.00
RP11090peptide : Calcitonin Gene Related Peptide (CGRP) (8-37), rat0.5 mg
$ 90.00
RP11092 peptide : Calcitonin Gene Related Peptide (CGRP) II, rat0.5 mg
$ 119.00
RP11093peptide : Calcitonin Gene Related Peptide (CGRP), chicken0.5 mg
$ 119.00
RP11095 peptide : Calcitonin Gene Related Peptide (CGRP), rat0.5 mg
$ 128.00




1
Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
2
Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptideTM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
3
Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
4
Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.




Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.