Peptide Products
You are here:  Products » Peptide Products » Catalog Peptides - Hot Products »  Secretin, chicken   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
Secretin, chicken

Cat. No. Size Price Figures
RP12944-0.2 mg
 		0.2 mg
$ 76.00
MSDS:  20080703225017  (PDF)

STRUCTURE:
Secretin structure
Zoom

References:
  • Nilsson A, et al. Isolation and characterization of chicken secretin. Eur. J. Biochem. Nov 1980; 112(2): 383-388.
  • Kiyama S, et al. Studies on peptides. CXIII. Synthesis of the heptacosapeptide amide corresponding to the entire amino acid sequence of chicken secretin.Int. J. Pept. Protein Res. Feb 1984; 23(2): 174-186.
Full Name
Secretin, chicken
Sequence
(one-letter code)		 HSDGLFTSEYSKMRGNAQVQKFIQNLM-NH2
Sequence
(three-letter code)		{HIS}{SER}{ASP}{GLY}{LEU}{PHE}{THR}{SER}{GLU}{TYR}
{SER}{LYS}{MET}{ARG}{GLY}{ASN}{ALA}{GLN}{VAL}{GLN}
{LYS}{PHE}{ILE}{GLN}{ASN}{LEU}{MET}-NH2
C-TerminalNH2
DescriptionChicken secretin is composed of 27 amino acid residues, and has an amidated C terminus. Chicken secretin further shows a clear structural similarity to the vasoactive intestinal peptide, the gastric inhibitory peptide and to glucagon, suggesting wide evolutionary and functional relationships.
SolubilitySoluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
FormulaC136H214N40O41S2
M.W.3129.54
Purity> 95%
StorageStore at -20°C. Keep tightly closed. Store in a cool dry place.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP10247peptide : Secretin, porcine0.5 mg
$ 61.75
RP10248 peptide : Secretin, rat0.5 mg
$ 61.75
RP10249peptide : Secretin, human1 mg
$ 90.25
RP12943 peptide : Secretin, canine0.2 mg
$ 76.00
RP12945peptide : Secretin, mouse0.2 mg
$ 142.50
GN061737 ORF Clone : LOC42301510 ug
$ 592.50



If you cannot find your peptides on our list, try our Express PeptideTM Service, and receive high-quality peptides in eight business days, guaranteed.

Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.