| Cat. No. |
Size |
Price |
Figures |
|---|
RP13323-0.2 mg
| 0.2 mg | $ 171.00 | HPLC: 20060721145624 (PDF)
MS: 20060721145604 (PDF)
MSDS: 20080821214318 (PDF)
References:
- Ouhara K, et al. Susceptibilities of periodontopathogenic and cariogenic bacteria to antibacterial peptides, {beta}-defensins and LL37, produced by human epithelial cells. J. Antimicrob. Chemother. Jun 2005; 55(6): 888-896.
- Steinstraesser L, et al. The human host defense peptide LL37/hCAP accelerates angiogenesis in PEGT/PBT biopolymers. Annals of plastic surgery. Jan 2006; 56(1): 93-98.
- Huang LC, et al. Multifunctional roles of human cathelicidin (LL-37) at the ocular surface.Invest. Ophthalmol. Vis. Sci. Jun 2006; 47(6): 2369-2380.
|
|---|
| Full Name | |
Sequence
(one-letter code) |
[LL-37, 37 aa] |
Sequence
(three-letter code) | {LEU}{LEU}{GLY}{ASP}{PHE}{PHE}{ARG}{LYS}{SER}{LYS}
{GLU}{LYS}{ILE}{GLY}{LYS}{GLU}{PHE}{LYS}{ARG}{ILE}
{VAL}{GLN}{ARG}{ILE}{LYS}
{ASP}{PHE}{LEU}{ARG}{ASN}{LEU}
{VAL}{PRO}{ARG}{THR}{GLU}{SER} |
|---|
| Description | The cathelicidin anti-microbial peptide LL-37 is involved in the reepithelialization of human skin wounds and is lacking in chronic ulcer epithelium. LL-37(human) is a cathelicidin-derived peptide with antimicrobial and angiogenic activity. |
|---|
| Solubility | Insoluble in water. Dissolve the peptide in 10% acetonitrile with 0.1% TFA solution. Further dilute with desired buffer. |
|---|
| Formula | C205H340N60O53 |
|---|
| M.W. | 4493.28 |
|---|
| Purity | > 95% |
|---|
| Storage | Store the product at -20°C. Keep container tightly closed. Store in a cool dry place. |
