Peptide Products
You are here:  Products » Peptide Products » Catalog Peptides - Hot Products »  LL37 (Human)   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
LL37 (Human)

Cat. No. Size Price Figures
RP13323-0.2 mg
 		0.2 mg
$ 171.00
HPLC:  20060721145624  (PDF)
MS:  20060721145604  (PDF)
MSDS:  20080821214318  (PDF)
HPLC:  20100304005241  (PDF)
MS:  20100304005255  (PDF)


References:
  • Ouhara K, et al. Susceptibilities of periodontopathogenic and cariogenic bacteria to antibacterial peptides, {beta}-defensins and LL37, produced by human epithelial cells. J. Antimicrob. Chemother. Jun 2005; 55(6): 888-896.
  • Steinstraesser L, et al. The human host defense peptide LL37/hCAP accelerates angiogenesis in PEGT/PBT biopolymers. Annals of plastic surgery. Jan 2006; 56(1): 93-98.
  • Huang LC, et al. Multifunctional roles of human cathelicidin (LL-37) at the ocular surface.Invest. Ophthalmol. Vis. Sci. Jun 2006; 47(6): 2369-2380.
Full Name
LL37 (Human)
Sequence
(one-letter code)		 [LL-37, 37 aa]
Sequence
(three-letter code)		{LEU}{LEU}{GLY}{ASP}{PHE}{PHE}{ARG}{LYS}{SER}{LYS}
{GLU}{LYS}{ILE}{GLY}{LYS}{GLU}{PHE}{LYS}{ARG}{ILE}
{VAL}{GLN}{ARG}{ILE}{LYS} {ASP}{PHE}{LEU}{ARG}{ASN}{LEU}
{VAL}{PRO}{ARG}{THR}{GLU}{SER}
DescriptionThe cathelicidin anti-microbial peptide LL-37 is involved in the reepithelialization of human skin wounds and is lacking in chronic ulcer epithelium. LL-37(human) is a cathelicidin-derived peptide with antimicrobial and angiogenic activity.
SolubilityInsoluble in water. Dissolve the peptide in 10% acetonitrile with 0.1% TFA solution. Further dilute with desired buffer.
FormulaC205H340N60O53
M.W.4493.28
Purity> 95%
StorageStore the product at -20°C. Keep container tightly closed. Store in a cool dry place.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
GN002631ORF Clone : CAMP10 ug
$ 641.00




1
 Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
2
 Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptideTM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
3
 Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
4
 Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.




Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.