You are here:  Products » Peptide Products » Catalog Peptides - Hot Products »  Galanin-Like Peptide, human   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
Galanin-Like Peptide, human

Cat. No. Size Price Figures
RP13435-0.1 mg
0.1 mg
$ 152.00
MSDS:  20080827032803  (PDF)


References:
  • Kuramochi M, et al. Galanin-like peptide stimulates food intake via activation of neuropeptide Y neurons in the hypothalamic dorsomedial nucleus of the rat. Endocrinology. Apr 2006, 147(4): 1744-1752.
  • Stoyanovitch AG, et al. Galanin-like peptide rescues reproductive function in the diabetic rat. Diabetes. Aug 2005, 54(8): 2471-2476.
  • Cunningham MJ, et al. Galanin-like peptide as a possible link between metabolism and reproduction in the macaque. J. Clin. Endocrinol. Metab. Apr 2004, 89(4): 1760-1766.
Full Name
Galanin-Like Peptide, human
Alias GALP
Sequence
(one-letter code)
APAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPS
Sequence
(three-letter code)
{ALA}{PRO}{ALA}{HIS}{ARG}{GLY}{ARG}{GLY}{GLY}{TRP}
{THR}{LEU}{ASN}{SER}{ALA}{GLY}{TYR}{LEU}{LEU}{GLY}
{PRO}{VAL}{LEU}{HIS}{LEU}{PRO}{GLN}{MET}{GLY}{ASP}
{GLN}{ASP}{GLY}{LYS}{ARG}{GLU}{THR}{ALA}{LEU}{GLU}
{ILE}{LEU}{ASP}{LEU}{TRP}{LYS}{ALA}{ILE}{ASP}{GLY}
{LEU}{PRO}{TYR}{SER}{HIS}{PRO}{PRO}{GLN}{PRO}{SER}
DescriptionGalanin-like peptide (GALP), a 29-amino-acid neuropeptide, is located in the hypothalamic arcuate nucleus (ARC), binds to galanin receptor subtype 2, and induces food intake.
SolubilitySoluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of their contents.
FormulaC292H451N83O84S1
M.W.6500.31
Purity> 95%
StorageBefore use, store the peptide in its dry form at 0-5°C. For best and most repeatable results, rehydrate the peptide immediately before use. Do not re-freeze any unused portions.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP10801peptide : Galanin, human0.5 mg
$ 90.25
RP13446 peptide : Galanin, bovine0.2 mg
$ 118.75
RP13439peptide : Galanin-Like Peptide, rat0.1 mg
$ 190.00
RP10803 peptide : Galanin, rat1 mg
$ 156.75
RP10802peptide : Galanin, porcine0.5 mg
$ 109.25
GN024820 ORF Clone : GALP10 ug
$ 438.75
GN316686ORF Clone : LOC46911010 ug
$ 438.75




Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.