| |
Galanin-Like Peptide, human  |
|
|

| Cat. No. |
Size |
Price |
Figures |
RP13435-0.1 mg
| 0.1 mg | $ 152.00 | MSDS: 20080827032803 (PDF) PROTOCOL: 20100407015038 (PDF)
References:
- Kuramochi M, et al. Galanin-like peptide stimulates food intake via activation of neuropeptide Y neurons in the hypothalamic dorsomedial nucleus of the rat.
Endocrinology. Apr 2006, 147(4): 1744-1752.
- Stoyanovitch AG, et al. Galanin-like peptide rescues reproductive function in the diabetic rat. Diabetes. Aug 2005, 54(8): 2471-2476.
- Cunningham MJ, et al. Galanin-like peptide as a possible link between metabolism and reproduction in the macaque. J. Clin. Endocrinol. Metab. Apr 2004, 89(4): 1760-1766.
|
|---|
| Full Name | | Galanin-Like Peptide, human |
|
| Alias |
GALP |
Sequence (one-letter code) |
APAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPS | Sequence (three-letter code) | {ALA}{PRO}{ALA}{HIS}{ARG}{GLY}{ARG}{GLY}{GLY}{TRP} {THR}{LEU}{ASN}{SER}{ALA}{GLY}{TYR}{LEU}{LEU}{GLY} {PRO}{VAL}{LEU}{HIS}{LEU}{PRO}{GLN}{MET}{GLY}{ASP} {GLN}{ASP}{GLY}{LYS}{ARG}{GLU}{THR}{ALA}{LEU}{GLU} {ILE}{LEU}{ASP}{LEU}{TRP}{LYS}{ALA}{ILE}{ASP}{GLY} {LEU}{PRO}{TYR}{SER}{HIS}{PRO}{PRO}{GLN}{PRO}{SER} | | Description | Galanin-like peptide (GALP), a 29-amino-acid neuropeptide, is located in the hypothalamic arcuate nucleus (ARC), binds to galanin receptor subtype 2, and induces food intake. |
|---|
| Solubility | Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of their contents. |
|---|
| Formula | C292H451N83O84S1 | | M.W. | 6500.31 | | Purity | > 95% | | Storage | Before use, store the peptide in its dry form at 0-5°C. For best and most repeatable results, rehydrate the peptide immediately before use. Do not re-freeze any unused portions. |
| * For Non-Clinical Research Use Only *
 |
1 |
Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
|
2 |
Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptideTM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
|
3 |
Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
|
4 |
Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.
|
Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.
|
|