You are here:  Products » Peptide Products » Catalog Peptides - Hot Products »  Galanin-Like Peptide, rat   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
Galanin-Like Peptide, rat

Cat. No. Size Price Figures
RP13439-0.1 mg
0.1 mg
$ 190.00
MSDS:  20080827042801  (PDF)


References:
  • Kuramochi M, et al. Galanin-like peptide stimulates food intake via activation of neuropeptide Y neurons in the hypothalamic dorsomedial nucleus of the rat. Endocrinology. Apr 2006; 147(4): 1744-1752.
  • Stoyanovitch AG, et al. Galanin-like peptide rescues reproductive function in the diabetic rat. Diabetes. Aug 2005; 54(8): 2471-2476.
  • Dong Y, et al. Galanin and galanin-like peptide differentially modulate neuronal activities in rat arcuate nucleus neurons. J. Neurophysiol. May 2006; 95(5): 3228-3234.
Full Name
Galanin-Like Peptide, rat
Alias GALP
Sequence
(one-letter code)
APAHRGRGGWTLNSAGYLLGPVLHLSSKANQGRKTDSALEILDLWKAIDGLPYSRSPRMT
Sequence
(three-letter code)
{ALA}{PRO}{ALA}{HIS}{ARG}{GLY}{ARG}{GLY}{GLY}{TRP}
{THR}{LEU}{ASN}{SER}{ALA}{GLY}{TYR}{LEU}{LEU}{GLY}
{PRO}{VAL}{LEU}{HIS}{LEU}{SER}{SER}{LYS}{ALA}{ASN}
{GLN}{GLY}{ARG}{LYS}{THR}{ASP}{SER}{ALA}{LEU}{GLU}
{ILE}{LEU}{ASP}{LEU}{TRP}{LYS}{ALA}{ILE}{ASP}{GLY}
{LEU}{PRO}{TYR}{SER}{ARG}{SER}{PRO}{ARG}{MET}{THR}
DescriptionGalanin-like peptide (GALP) is a novel hypothalamic peptide. Galanin-like peptide (GALP) is synthesized in neurons in the arcuate nucleus which project to the paraventricular nucleus (PVN). GALP has recently been identified as an orexigenic peptide. In the PVN, GALP may play a role in energy homeostasis by stimulating food intake and suppressing TSH release.
SolubilityInsoluble in water. Dissolve peptide in 30-50 µl of 60% Acetonitrile in water with 0.1%TFA then dilute it up with any desired buffer
FormulaC288H461N87O83S
M.W.6502.37
Purity> 95%
StorageStore at -20°C. Keep tightly closed.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP10801peptide : Galanin, human0.5 mg
$ 90.25
RP13446 peptide : Galanin, bovine0.2 mg
$ 118.75
RP13435peptide : Galanin-Like Peptide, human0.1 mg
$ 152.00
RP10803 peptide : Galanin, rat1 mg
$ 156.75
RP10802peptide : Galanin, porcine0.5 mg
$ 109.25
GN080627 ORF Clone : Galp10 ug
$ 435.00




Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.