You are here:  Products » Peptides&Biochemicals » Catalog Peptides - Hot Products »  Galanin-Like Peptide, rat   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
Galanin-Like Peptide, rat

Cat. No. Size Price Figures
RP13439-0.1 mg
0.1 mg
$ 190.00
MSDS:  20080827042801  (PDF)
PROTOCOL:  20100407015038  (PDF)


References:
  • Kuramochi M, et al. Galanin-like peptide stimulates food intake via activation of neuropeptide Y neurons in the hypothalamic dorsomedial nucleus of the rat. Endocrinology. Apr 2006; 147(4): 1744-1752.
  • Stoyanovitch AG, et al. Galanin-like peptide rescues reproductive function in the diabetic rat. Diabetes. Aug 2005; 54(8): 2471-2476.
  • Dong Y, et al. Galanin and galanin-like peptide differentially modulate neuronal activities in rat arcuate nucleus neurons. J. Neurophysiol. May 2006; 95(5): 3228-3234.
Full Name
Galanin-Like Peptide, rat
Alias GALP
Sequence
(one-letter code)
APAHRGRGGWTLNSAGYLLGPVLHLSSKANQGRKTDSALEILDLWKAIDGLPYSRSPRMT
Sequence
(three-letter code)
{ALA}{PRO}{ALA}{HIS}{ARG}{GLY}{ARG}{GLY}{GLY}{TRP}
{THR}{LEU}{ASN}{SER}{ALA}{GLY}{TYR}{LEU}{LEU}{GLY}
{PRO}{VAL}{LEU}{HIS}{LEU}{SER}{SER}{LYS}{ALA}{ASN}
{GLN}{GLY}{ARG}{LYS}{THR}{ASP}{SER}{ALA}{LEU}{GLU}
{ILE}{LEU}{ASP}{LEU}{TRP}{LYS}{ALA}{ILE}{ASP}{GLY}
{LEU}{PRO}{TYR}{SER}{ARG}{SER}{PRO}{ARG}{MET}{THR}
DescriptionGalanin-like peptide (GALP) is a novel hypothalamic peptide. Galanin-like peptide (GALP) is synthesized in neurons in the arcuate nucleus which project to the paraventricular nucleus (PVN). GALP has recently been identified as an orexigenic peptide. In the PVN, GALP may play a role in energy homeostasis by stimulating food intake and suppressing TSH release.
SolubilityInsoluble in water. Dissolve peptide in 30-50 µl of 60% Acetonitrile in water with 0.1%TFA then dilute it up with any desired buffer
FormulaC288H461N87O83S
M.W.6502.37
Purity> 95%
StorageStore at -20°C. Keep tightly closed.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP10801peptide : Galanin, human0.5 mg
$ 90.00
RP13446 peptide : Galanin, bovine0.2 mg
$ 119.00
RP13435peptide : Galanin-Like Peptide, human0.1 mg
$ 152.00
RP10803 peptide : Galanin, rat1 mg
$ 157.00
RP10802peptide : Galanin, porcine0.5 mg
$ 109.00
GN080627 ORF Clone : Galp10 ug
$ 308.00




1
Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
2
Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptideTM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
3
Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
4
Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.




Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.