A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
Galanin, bovine

Cat. No. Size Price Figures
RP13446-0.2 mg
0.2 mg
$ 118.75
MSDS:  20080827052025  (PDF)

EXAMPLE:
Galanin Structure
Zoom

References:
  • Page AJ, et al. Modulation of gastro-oesophageal vagal afferents by galanin in mouse and ferret. J. Physiol. Mar 2005; 563(Pt 3): 809-819.
  • Sarnelli G, et al. Inhibitory effects of galanin on evoked [Ca2+]i responses in cultured myenteric neurons. Am. J. Physiol. Gastrointest. Liver Physiol. Jun 2004; 286(6): G1009-1014.
  • Seth A, et al. Galanin-like peptide stimulates the release of gonadotropin-releasing hormone in vitro and may mediate the effects of leptin on the hypothalamo-pituitary-gonadal axis. Endocrinology. Feb 2004; 145(2): 743-750.
Full Name
Galanin, bovine
Sequence
(one-letter code)
GWTLNSAGYLLGPHALDSHRSFQDKHGLA-NH2
Sequence
(three-letter code)
{GLY}{TRP}{THR}{LEU}{ASN}{SER}{ALA}{GLY}{TYR}{LEU}
{LEU}{GLY}{PRO}{HIS}{ALA}{LEU}{ASP}{SER}{HIS}{ARG}
{SER}{PHE}{GLN}{ASP}{LYS}{HIS}{GLY}{LEU}{ALA}
C-TerminalNH2
DescriptionGalanin is a neuropeptide which is not a member of any known family of neuropeptides. Galanin's actions are mediated via Gi-protein-coupled receptors and ion channels, usually producing inhibition of secretion of a transmitter or hormone in the nervous and endocrine system. In many respects, these inhibitory actions of galanin remind us of those of gamma-aminobutyric acid (GABA) and of neuropeptide Y (NPY). Galanin coexists with GABA, noradrenaline, 5-hydroxytryptamine (5-HT), and NPY in several regions of the brain.
SolubilitySoluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
FormulaC141H211N43O40
M.W.3148.46
Purity> 95%
StorageBefore using, store the peptide in the DRY form at 0 - 5°C. For best and repeatable results, rehydrate the peptide immediately before using. Do not re-freeze any unused portions.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP10801peptide : Galanin, human0.5 mg
$ 90.25
RP10802 peptide : Galanin, porcine0.5 mg
$ 109.25
RP10803peptide : Galanin, rat1 mg
$ 156.75
RP13435 peptide : Galanin-Like Peptide, human0.1 mg
$ 152.00
RP13439peptide : Galanin-Like Peptide, rat0.1 mg
$ 190.00
GN153762 ORF Clone : GAL10 ug
$ 465.00



If you cannot find your peptides on our list, try our Express PeptideTM Service, and receive high-quality peptides in eight business days, guaranteed.

Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.