You are here:  Products » Peptide Products » Catalog Peptides - Hot Products »  β-Endorphin, equine   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
β-Endorphin, equine

Cat. No. Size Price Figures
RP13506-0.2 mg
0.2 mg
$ 57.00
MSDS:  20080909234617  (PDF)


References:
  • Mills RH, et al. Estrogen-induced mu-opioid receptor internalization in the medial preoptic nucleus is mediated via neuropeptide Y-Y1 receptor activation in the arcuate nucleus of female rats. J. Neurosci. Jan 2004 28; 24(4): 947-955.
  • Taskin O, et al. Placebo-controlled cross-over study of effects of tibolone on premenstrual symptoms and peripheral beta-endorphin concentrations in premenstrual syndrome. Hum. Reprod. Sep 1998; 13(9): 2402-2405.
  • Sharp BM, et al. Signaling through delta opioid receptors on murine splenic T cells and stably transfected Jurkat cells. Ann. N. Y. Acad. Sci. May 1998; 840: 420-424.
Full Name
β-Endorphin, equine
Sequence
(one-letter code)
YGGFMSSEKSQTPLVTLFKNAIIKNAHKKGQ
Sequence
(three-letter code)
{TYR}{GLY}{GLY}{PHE}{MET}{SER}{SER}{GLU}{LYS}{SER}
{GLN}{THR}{PRO}{LEU}{VAL}{THR}{LEU}{PHE}{LYS}{ASN}
{ALA}{ILE}{ILE}{LYS}{ASN}{ALA}{HIS}{LYS}{LYS}{GLY}
{GLN}
DescriptionEndorphin Beta is A substance produced in the brain, especially in the pituitary gland, Endorphin Beta blocks the sensation of pain. Endorphin Beta is produced in response to pain, exercise, and other forms of stress. Endorphin Beta belongs to a group of chemicals called polypeptide hormones.
FormulaC154H248N42O44S1
M.W.3423.95
Purity> 95%
StorageStore at -20°C
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP11328peptide : α-Endorphin1 mg
$ 42.75
RP11333 peptide : N-Acetyl-α-Endorphin1 mg
$ 47.50
RP11343peptide : β-Endorphin, camel1 mg
$ 109.25
RP11344 peptide : β-Endorphin, human1 mg
$ 71.25
RP11346peptide : β-Endorphin, rat1 mg
$ 118.75




Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.