You are here:  Products » Peptide Products » Catalog Peptides - Hot Products »  β-Endorphin, equine   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
β-Endorphin, equine

Cat. No. Size Price Figures
RP13506-0.2 mg
0.2 mg
$ 57.00
MSDS:  20080909234617  (PDF)
HPLC:  20091214024244  (PDF)
MS:  20091214024320  (PDF)


References:
  • Mills RH, et al. Estrogen-induced mu-opioid receptor internalization in the medial preoptic nucleus is mediated via neuropeptide Y-Y1 receptor activation in the arcuate nucleus of female rats. J. Neurosci. Jan 2004 28; 24(4): 947-955.
  • Taskin O, et al. Placebo-controlled cross-over study of effects of tibolone on premenstrual symptoms and peripheral beta-endorphin concentrations in premenstrual syndrome. Hum. Reprod. Sep 1998; 13(9): 2402-2405.
  • Sharp BM, et al. Signaling through delta opioid receptors on murine splenic T cells and stably transfected Jurkat cells. Ann. N. Y. Acad. Sci. May 1998; 840: 420-424.
Full Name
β-Endorphin, equine
Sequence
(one-letter code)
YGGFMSSEKSQTPLVTLFKNAIIKNAHKKGQ
Sequence
(three-letter code)
{TYR}{GLY}{GLY}{PHE}{MET}{SER}{SER}{GLU}{LYS}{SER}
{GLN}{THR}{PRO}{LEU}{VAL}{THR}{LEU}{PHE}{LYS}{ASN}
{ALA}{ILE}{ILE}{LYS}{ASN}{ALA}{HIS}{LYS}{LYS}{GLY}
{GLN}
DescriptionEndorphin Beta is A substance produced in the brain, especially in the pituitary gland, Endorphin Beta blocks the sensation of pain. Endorphin Beta is produced in response to pain, exercise, and other forms of stress. Endorphin Beta belongs to a group of chemicals called polypeptide hormones.
FormulaC154H248N42O44S1
M.W.3423.95
Purity> 95%
StorageStore at -20°C
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP11328peptide : α-Endorphin1 mg
$ 43.00
RP11333 peptide : N-Acetyl-α-Endorphin1 mg
$ 48.00
RP11343peptide : β-Endorphin, camel1 mg
$ 109.00
RP11344 peptide : β-Endorphin, human1 mg
$ 71.00
RP11346peptide : β-Endorphin, rat1 mg
$ 119.00




1
Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
2
Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptideTM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
3
Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
4
Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.




Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.