| Cat. No. |
Size |
Price |
Figures |
|---|
RP13702-0.2 mg
| 0.2 mg | $ 142.50 | MSDS: 20080911221147 (PDF)
References:
- Marti E, et al. Early induction of secretoneurin expression following kainic acid administration at convulsant doses in the rat and gerbil hippocampus. Hippocampus. 2002; 12(2): 174-185.
- Troger J, et al. Secretoneurin in the peripheral ocular innervation. Invest. Ophthalmol. Vis. Sci. Feb 2005; 46(2): 647-654.
- Fischer-Colbrie R, et al. Secretoneurin: a new player in angiogenesis and chemotaxis linking nerves, blood vessels and the immune system. Curr. Protein Pept. Sci. Aug 2005; 6(4): 373-385.
|
|---|
| Full Name | |
| Alias |
Secretogranin II |
Sequence
(one-letter code) |
TNEIVEEQYTPQSLATLESVFQELGKLTGPSNQ |
Sequence
(three-letter code) | {THR}{ASN}{GLU}{ILE}{VAL}{GLU}{GLU}{GLN}{TYR}{THR}
{PRO}{GLN}{SER}{LEU}{ALA}{THR}{LEU}{GLU}{SER}{VAL}
{PHE}{GLN}{GLU}{LEU}{GLY}{LYS}{LEU}{THR}{GLY}{PRO}
{SER}{ASN}{GLN} |
|---|
| Description | Secretoneurin (Rat) is a neuropeptide generated in brain, adrenal medulla and other endocrine tissues by proteolytic processing of secretogranin II (chromogranin C). The endogenous peptide can enhance dopamine release.
|
|---|
| Solubility | Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. |
|---|
| Formula | C159H252N40O58 |
|---|
| M.W. | 3651.95 |
|---|
| Purity | > 95% |
|---|
| Storage | Storage at -20°C. Keep tightly closed. |
