GenScript Catalog Peptide: Secretoneurin, rat (RP13702)

Peptide Products

You are here: Products » Peptide Products » Catalog Peptides - Hot Products » Secretoneurin, rat

A B C D E F G H I J K L M N O P Q R S T U V W X Y Z ALL HotProducts

Secretoneurin, rat

Cat. No.

Size

Price

Figures

RP13702-0.2 mg

0.2 mg

$ 142.00

MSDS: 20080911221147 (PDF)

References:

Marti E, et al. Early induction of secretoneurin expression following kainic acid administration at convulsant doses in the rat and gerbil hippocampus. Hippocampus. 2002; 12(2): 174-185.
Troger J, et al. Secretoneurin in the peripheral ocular innervation. Invest. Ophthalmol. Vis. Sci. Feb 2005; 46(2): 647-654.
Fischer-Colbrie R, et al. Secretoneurin: a new player in angiogenesis and chemotaxis linking nerves, blood vessels and the immune system. Curr. Protein Pept. Sci. Aug 2005; 6(4): 373-385.

Full Name

Secretoneurin, rat

Alias

Secretogranin II

Sequence
(one-letter code)

TNEIVEEQYTPQSLATLESVFQELGKLTGPSNQ

Sequence
(three-letter code)

{THR}{ASN}{GLU}{ILE}{VAL}{GLU}{GLU}{GLN}{TYR}{THR}
{PRO}{GLN}{SER}{LEU}{ALA}{THR}{LEU}{GLU}{SER}{VAL}
{PHE}{GLN}{GLU}{LEU}{GLY}{LYS}{LEU}{THR}{GLY}{PRO}
{SER}{ASN}{GLN}

Description

Secretoneurin (Rat) is a neuropeptide generated in brain, adrenal medulla and other endocrine tissues by proteolytic processing of secretogranin II (chromogranin C). The endogenous peptide can enhance dopamine release.

Solubility

Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.

Formula

C₁₅₉H₂₅₂N₄₀O₅₈

M.W.

3651.95

Purity

> 95%

Storage

Storage at -20�C. Keep tightly closed.

* For Non-Clinical Research Use Only *


1	Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
2	Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptide^TM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
3	Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (²H, ¹⁵N, and ¹³C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
4	Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.

Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.