A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
Amylin, feline

Cat. No. Size Price Figures
RP13732-0.5 mg
0.5 mg
$ 238.00
MSDS:  20080911234247  (PDF)
PROTOCOL:  20100407015038  (PDF)


References:
  • Alevizaki M, et al. High plasma amylin/islet amyloid polypeptide levels in patients with residual medullary thyroid carcinoma after total thyroidectomy. Eur. J. Endocrinol. Nov 2001; 145(5): 585-589.
  • Henseleit KD, et al. NKX6 transcription factor activity is required for alpha- and beta-cell development in the pancreas. Development. Jul 2005; 132(13): 3139-3149.
  • Wickner RB, et al. Prions: proteins as genes and infectious entities. Genes Dev. Mar 2004; 18(5): 470-485.
Full Name
Amylin, feline
Alias IAPP, DAP
Sequence
(one-letter code)
KCNTATCATQRLANFLIRSSNNLGAILSPTNVGSNTY-NH2
Sequence
(three-letter code)
{LYS}{CYS}{ASN}{THR}{ALA}{THR}{CYS}{ALA}{THR}{GLN}
{ARG}{LEU}{ALA}{ASN}{PHE}{LEU}{ILE}{ARG}{SER}{SER}
{ASN}{ASN}{LEU}{GLY}{ALA}{ILE}{LEU}{SER}{PRO}{THR}
{ASN}{VAL}{GLY}{SER}{ASN}{THR}{TYR}-NH2
C-TerminalNH2
Chemical BridgeCys2-Cys7
DescriptionAmylin is produced in the pancreas beta cells and coreleased with insulin. Amylin's amino acid sequence shows great homology with CGRP. Amylin has been shown to reverse insulin inhibition of hepatic gluconeogenesis and to inhibit muscle uptake of glucose.
SolubilityInsoluble in water. Dissolve peptide with 10% Acetonitrile in water.
FormulaC165H272N52O54S2
M.W.3912.42
Purity> 95%
StorageLyophilized powder may be stored at 4°C for short-term only. Reconstitute to nominal volume by adding sterile 40-50% glycerol and store at -20°C. Reconstituted product is stable for 24 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
NotesThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP11276peptide : Amylin (8-37), human0.5 mg
$ 128.00
RP11277 peptide : Amylin (8-37), amide, rat0.5 mg
$ 81.00
RP11280peptide : Amylin, amide, rat0.5 mg
$ 109.00




1
Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
2
Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptideTM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
3
Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
4
Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.




Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.