| Cat. No. |
Size |
Price |
Figures |
|---|
RP13758-0.1 mg
| 0.1 mg | $ 171.00 | MSDS: 20080912014834 (PDF)
References:
- Mittra S, Bourreau JP. Gs and Gi coupling of adrenomedullin in adult rat ventricular myocytes. Am. J. Physiol. Heart Circ. Physiol. May 2006; 290(5):H1842-H1847.
- Kato J, et al. Adrenomedullin: a protective factor for blood vessels. Arterioscler. Thromb. Vasc. Biol. Dec 2005; 25(12):2480-2487.
- Hwang IS, et al. Co-expression of adrenomedullin and adrenomedullin receptors in rat epididymis: distinct physiological actions on anion transport. Biol. Reprod. Jun 2003; 68(6):2005-2012.
|
|---|
| Full Name | | Adrenomedullin (AM), canine |
|
Sequence
(one-letter code) |
YRQSMNNFQGPRSFGCRFGTCTVQKLAHQIYQFTDNDKDGVAPRSKISPQGY-NH2 |
Sequence
(three-letter code) | {TYR}{ARG}{GLN}{SER}{MET}{ASN}{ASN}{PHE}{GLN}{GLY}
{PRO}{ARG}{SER}{PHE}{GLY}{CYS}{ARG}{PHE}{GLY}{THR}
{CYS}{THR}{VAL}{GLN}{LYS}{LEU}{ALA}{HIS}{GLN}{ILE}
{TYR}{GLN}{PHE}{THR}{ASP}{ASN}{ASP}{LYS}{ASP}{GLY}
{VAL}{ALA}{PRO}{ARG}{SER}{LYS}{ILE}{SER}{PRO}{GLN}
{GLY}{TYR}-NH2 |
|---|
| C-Terminal | NH2 |
|---|
| Chemical Bridge | Disulfide bridge: Cys16-Cys21 |
|---|
| Description | Adrenomedullin is a recently discovered peptide. Adrenomedullin was first purified from phaeochromocytoma tissue. Adrenomedullin has marked vasodilatory activity, and can cause hypotension. |
|---|
| Solubility | The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents. |
|---|
| Formula | C259H393N79O77S3 |
|---|
| M.W. | 5941.6 |
|---|
| Purity | > 95% |
|---|
| Storage | Before use, store the peptide in the DRY form at 0°C-5°C. For best and most repeatable results, rehydrate the peptide immediately before use. Do not re-freeze any unused portions. |
