You are here:  Products » Peptide Products » Catalog Peptides - Hot Products »  Adrenomedullin (AM), canine   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
Adrenomedullin (AM), canine

Cat. No. Size Price Figures
RP13758-0.1 mg
0.1 mg
$ 171.00
MSDS:  20080912014834  (PDF)


References:
  • Mittra S, Bourreau JP. Gs and Gi coupling of adrenomedullin in adult rat ventricular myocytes. Am. J. Physiol. Heart Circ. Physiol. May 2006; 290(5):H1842-H1847.
  • Kato J, et al. Adrenomedullin: a protective factor for blood vessels. Arterioscler. Thromb. Vasc. Biol. Dec 2005; 25(12):2480-2487.
  • Hwang IS, et al. Co-expression of adrenomedullin and adrenomedullin receptors in rat epididymis: distinct physiological actions on anion transport. Biol. Reprod. Jun 2003; 68(6):2005-2012.
Full Name
Adrenomedullin (AM), canine
Sequence
(one-letter code)
YRQSMNNFQGPRSFGCRFGTCTVQKLAHQIYQFTDNDKDGVAPRSKISPQGY-NH2
Sequence
(three-letter code)
{TYR}{ARG}{GLN}{SER}{MET}{ASN}{ASN}{PHE}{GLN}{GLY}
{PRO}{ARG}{SER}{PHE}{GLY}{CYS}{ARG}{PHE}{GLY}{THR}
{CYS}{THR}{VAL}{GLN}{LYS}{LEU}{ALA}{HIS}{GLN}{ILE}
{TYR}{GLN}{PHE}{THR}{ASP}{ASN}{ASP}{LYS}{ASP}{GLY}
{VAL}{ALA}{PRO}{ARG}{SER}{LYS}{ILE}{SER}{PRO}{GLN}
{GLY}{TYR}-NH2
C-TerminalNH2
Chemical BridgeDisulfide bridge: Cys16-Cys21
DescriptionAdrenomedullin is a recently discovered peptide. Adrenomedullin was first purified from phaeochromocytoma tissue. Adrenomedullin has marked vasodilatory activity, and can cause hypotension.
SolubilityThe peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
FormulaC259H393N79O77S3
M.W.5941.6
Purity> 95%
StorageBefore use, store the peptide in the DRY form at 0°C-5°C. For best and most repeatable results, rehydrate the peptide immediately before use. Do not re-freeze any unused portions.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP11291peptide : Adrenomedullin (AM) (13-52), human0.5 mg
$ 213.75
RP11293 peptide : Adrenomedullin (AM) (22-52), human0.5 mg
$ 90.25
RP11288peptide : Adrenomedullin (AM) (1-52), human0.5 mg
$ 261.25
GN044185 ORF Clone : ADM10 ug
$ 708.75




Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.