Peptides&Biochemicals
You are here:  Products » Peptides&Biochemicals » Catalog Peptides - Hot Products »  Adrenomedullin (AM), canine   
 
A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X  Y  Z  ALL  HotProducts  
Search by Catalog Number :(eg.RP01001)
Search by Name :(eg.Parathyroid Hormone (PTH))
Search by Sequence : (One letter code)
Search by Sequence : (Three letter code)

 
Adrenomedullin (AM), canine

Cat. No. Size Price Figures
RP13758-0.1 mg
 		0.1 mg
$ 171.00
MSDS:  20080912014834  (PDF)
PROTOCOL:  20100407015038  (PDF)


References:
  • Mittra S, Bourreau JP. Gs and Gi coupling of adrenomedullin in adult rat ventricular myocytes. Am. J. Physiol. Heart Circ. Physiol. May 2006; 290(5):H1842-H1847.
  • Kato J, et al. Adrenomedullin: a protective factor for blood vessels. Arterioscler. Thromb. Vasc. Biol. Dec 2005; 25(12):2480-2487.
  • Hwang IS, et al. Co-expression of adrenomedullin and adrenomedullin receptors in rat epididymis: distinct physiological actions on anion transport. Biol. Reprod. Jun 2003; 68(6):2005-2012.
Full Name
Adrenomedullin (AM), canine
Sequence
(one-letter code)		 YRQSMNNFQGPRSFGCRFGTCTVQKLAHQIYQFTDNDKDGVAPRSKISPQGY-NH2
Sequence
(three-letter code)		{TYR}{ARG}{GLN}{SER}{MET}{ASN}{ASN}{PHE}{GLN}{GLY}
{PRO}{ARG}{SER}{PHE}{GLY}{CYS}{ARG}{PHE}{GLY}{THR}
{CYS}{THR}{VAL}{GLN}{LYS}{LEU}{ALA}{HIS}{GLN}{ILE}
{TYR}{GLN}{PHE}{THR}{ASP}{ASN}{ASP}{LYS}{ASP}{GLY}
{VAL}{ALA}{PRO}{ARG}{SER}{LYS}{ILE}{SER}{PRO}{GLN}
{GLY}{TYR}-NH2
C-TerminalNH2
Chemical BridgeDisulfide bridge: Cys16-Cys21
DescriptionAdrenomedullin is a recently discovered peptide. Adrenomedullin was first purified from phaeochromocytoma tissue. Adrenomedullin has marked vasodilatory activity, and can cause hypotension.
SolubilityThe peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
FormulaC259H393N79O77S3
M.W.5941.6
Purity> 95%
StorageBefore use, store the peptide in the DRY form at 0°C-5°C. For best and most repeatable results, rehydrate the peptide immediately before use. Do not re-freeze any unused portions.
* For Non-Clinical Research Use Only *
Related Products:
CodeNameSizePrice 
RP11291peptide : Adrenomedullin (AM) (13-52), human0.5 mg
$ 214.00
RP11293 peptide : Adrenomedullin (AM) (22-52), human0.5 mg
$ 90.00
RP11288peptide : Adrenomedullin (AM) (1-52), human0.5 mg
$ 261.00
GN044185
$




1
 Peptide Services: GenScript's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
2
 Standard Peptide Synthesis: GenScript offers quality peptides at the most competitive prices in the industry, starting at $2.56 per amino acid. GenScript FlexPeptideTM technology can synthesize peptide as long as 200 amino acids, a world record for such technology.
3
 Peptide Modifications: GenScript offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.
4
 Peptide Libraries: GenScript has developed a rapid high-throughput parallel peptide synthesis platform, providing custom libraries of unbound peptides of 5-20 mer at very competitive prices.




Our customer service is available 24 hours a day, Monday through Friday. You may contact us any time for assistance.