Catalog Products » Recombinant Proteins » Chemokines » MCP-4/CCL13, Human
GenScript Share
 
Search by Catalog Number :
Search by Name :
Search by Sequence : (One letter code)
Search by Category :



MCP-4/CCL13, Human



Cat. No.
Name
Size   
Price
Selected
Z02836-1
1 mg
$2,400
Z02836-20
20 μg
$157

Full Name MCP-4/CCL13, Human
Abbreviated Name-1
MCP-4/CCL13, Human;
Documents
MCP-4/CCL13, HumanDocument-MSDS: 15372_20120105035047.PDF (PDF)
MCP-4/CCL13, HumanDocument-COA: Z02836_R51181204.pdf (pdf)
Figures
Reference
Description
CCL13 is a chemoattractant for monocytes and eosinophils, and activates basophils. In addition, it has been reported to be chemotactic for CD4+ and CD8+ T cells, with an activity almost equivalent to that of MCP-3. The bioactivities of CCL13 is most likely mediated by the CC chemokine receptors CCR-2 and CCR-3, both of which have been shown to bind CCL13.
Source
Escherichia coli.
M.W.
8.6 kDa, a single non-glycosylated polypeptide chain containing 75 amino acids.
Purity
>96% by SDS-PAGE and HPLC analyses.
Endotoxin Level
Less than 0.2EU/ug of rHuMCP-4/CCL13 as determined by LAL method.
Specific Activity
Fully biologically active when compared to standard. The ED50 determined by a chemotaxis bioassay using human monocytes is less than 100 ng/ml, corresponding to a specific activity of > 1.0 × 104 IU/mg.
Storage
This lyophilized preparation is stable at 2-8 °C, but should be kept at -20 °C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 °C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 °C to -70 °C. Avoid repeated freeze/thaw cycles.
Formulation
Lyophilized from a 0.2µm filtered concentrated solution in 20mM PB, pH 7.4, 130mM NaCl.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 °C. Further dilutions should be made in appropriate buffered solutions.
Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Usage
This material is for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE.
Sequence

QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT
1
Custom Recombinant Protein Services: Guaranteed E. coli Expression Package-3 mg purified soluble protein from $2,200 .
2
Bacterial Expression System: GenScript has developed BacPowerTM technologies to tackle hard-to-express and hard-to-dissolve proteins.
3
Yeast Expression System: GenScript's proprietary YeastHIGHTM technology combines the advantages of the bacterial and eukaryotic expression systems.
4
Baculovirus/Insect Cell Expression System: GenScript developed BacuVanceTM platform for the secretion of recombinant proteins from baculovirus-infected insect cells.
5
Mammalian Cell Expression System: The proprietary 293 and CHO suspension system platform promotes fast production and delivery of recombinant proteins and monoclonal antibodies up to grams level.