• English
  • Sign In
  • Contact Us
×
Catalog Products » Other Products » Catalog Peptides » All Catalog Peptides » Peptide YY (PYY), human

Peptide YY (PYY), human

Synonyms PYY
Description Peptide YY (PYY) is mainly found in gastrointestinal tract. It is believed to involve feeding behavior. It is a gut hormone that inhibits both secretin- and cholecystokinin-stimulated pancreatic secretion. This peptide is an endogenous nonselective agonist at NPY receptors.
Cas No 118997-30-1
Sequence
{TYR}{PRO}{ILE}{LYS}{PRO}{GLU}{ALA}{PRO}{GLY}{GLU}{ASP}{ALA}{SER}{PRO}{GLU}{GLU}{LEU}{ASN}{ARG}{TYR}{TYR}{ALA}{SER}{LEU}{ARG}{HIS}{TYR}{LEU}{ASN}{LEU}{VAL}{THR}{ARG}{GLN}{ARG}{TYR}-NH2
Sequence Shortening YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
Molecular Formula C194H295N55O57
C Terminal NH2
Molecular Weight 4309.75

Purity > 95%
Gmp Flag 0
Anaspec Cat No Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
Storage Store the peptide at -20°C. Keep container tightly closed.
Note


Cat. No.
Product Name
Price
RP10354-0.5
Peptide YY (PYY) (3-36), human - 0.5 mg
$114.00
 
le Roux CW, et al. Attenuated peptide YY release in obese subjects is associated with reduced satiety. Endocrinology. Jan 2006;147(1):3-8.

Ahituv N, et al. A PYY Q62P variant linked to human obesity. Hum Mol Genet. Feb 1 2006;15(3):387-391.

Kim BJ, et al. Peptide YY is secreted after oral glucose administration in a gender-specific manner. J Clin Endocrinol Metab. Dec 2005;90(12):6665-6671.

Wendy A. Hegefeld., et al. Structural dynamics of neuropeptide hPYY. Biopolymers. 2011 Jul;95(7):487-502.

You can visit "Citations Database" for more citations.







For more documents, please visit "Technical Support".

Cat. No. RP10355
Size
Price
1 mg $200.00