• English
  • Sign In
  • Contact Us
×
Catalog Products » Neuropeptide Y, human

Neuropeptide Y, human

Synonyms NPY
Description Neuropeptide Y (NPY) is a vasoconstrictor and a brain peptide that inhibits Ca2+-activated K+ channels in vascular smooth muscle. Neuropeptide Y (NPY) is implicated in the control of blood pressure, sexual behavior, and food intake. Neuropeptide Y (NPY) inhibits cholecystokinin- and secretin-stimulated pancreatic secretion.
Cas No 90880-35-6
Sequence
{TYR}{PRO}{SER}{LYS}{PRO}{ASP}{ASN}{PRO}{GLY}{GLU}{ASP}{ALA}{PRO}{ALA}{GLU}{ASP}{MET}{ALA}{ARG}{TYR}{TYR}{SER}{ALA}{LEU}{ARG}{HIS}{TYR}{ILE}{ASN}{LEU}{ILE}{THR}{ARG}{GLN}{ARG}{TYR}-NH2
Sequence Shortening YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
Molecular Formula C189H285N55O57S1
C Terminal NH2
Molecular Weight 4271.68

Purity > 95%
Solubility Solvent: 1 mg/ml CH3COOH 0.05 M clear, colorless
Gmp Flag 0
Storage Store at -20°C.
Note

  • Neuropeptide Y, Human
  • Neuropeptide Y, Human


Cat. No.
Product Name
Price
RP10488-5
Neuropeptide Y (13-36), human - 5 mg
$380.00
 
Amlal H, et al. Estrogen up-regulates neuropeptide Y Y1 receptor expression in a human breast cancer cell line. Cancer Res. Apr 2006; 66(7): 3706-3714.

Bromee T, et al. Neuropeptide Y-family receptors Y and Y in chicken. Cloning, pharmacological characterization, tissue distribution and conserved synteny with human chromosome region. FEBS. J. May 2006; 273(9): 2048-2063.

Thiriet N, et al. Neuropeptide Y protects against methamphetamine-induced neuronal apoptosis in the mouse striatum. J. Neurosci. Jun 2005; 25(22): 5273-5279.

You can visit "Citations Database" for more citations.







For more documents, please visit "Technical Support".

Cat. No. RP10492
Size
Price
0.5 mg $71.00