• English
  • Sign In
  • Contact Us
×
Home » Gene Synthesis & Molecular Biology Services » Glucagon-Like Peptide (GLP) II, human

Glucagon-Like Peptide (GLP) II, human

Synonyms Glucagon-Like PeptideII; Glucagon-Like Peptide 2; Glucagon-Like Peptide2; GLP II; GLPII; GLP 2; GLP2
Description Glucagon-like peptide 2 (GLP-2) is a recently identified intestinal epithelium-specific growth factor that has been shown to reduce the severity of inflammatory disorders of the intestine in rodent models. Currently Glucagon-Like Peptide 2 is used as a potential therapeutic agent for the human subjects with a broad variety of intestinal diseases characterized by intestinal damage and insufficiency.
Cas No 223460-79-5
Sequence
{HIS}{ALA}{ASP}{GLY}{SER}{PHE}{SER}{ASP}{GLU}{MET}{ASN}{THR}
{ILE}{LEU}{ASP}{ASN}{LEU}{ALA}{ALA}{ARG}{ASP}{PHE}{ILE}{ASN}
{TRP}{LEU}{ILE}{GLN}{THR}{LYS}{ILE}{THR}{ASP}
Sequence Shortening HADGSFSDEMNTILDNLAARDFINWLIQTKITD
Molecular Formula C165H254N44O55S1
Molecular Weight 3766.2

Purity > 95%
Gmp Flag 0
Storage Store the peptide at -20°C. Keep container tightly closed.
Note


Cat. No.
Product Name
Price
RP12738-0.5
Glucagon-Like Peptide (GLP) I (7-37) - 0.5 mg
$119.00
RP10773-0.5
Glucagon-Like Peptide (GLP) I (7-36), amide, human - 0.5 mg
$90.00
 
Stephens J, et al. Glucagon-like peptide-2 acutely increases proximal small intestinal blood flow in TPN-fed neonatal piglets. Am. J. Physiol. Regul. Integr. Comp. Physiol. Feb 2006; 290(2): R283-R289.

Chance WT, et al. The role of polyamines in glucagon-like peptide-2 prevention of TPN-induced gut hypoplasia. Peptides. Apr 2006; 27(4): 883-892.

Sams A, et al. Naturally occurring glucagon-like peptide-2 (GLP-2) receptors in human intestinal cell lines. Eur. J. Pharmacol. Feb 2006; 532(1-2): 18-23.

You can visit "Citations Database" for more citations.







For more documents, please visit "Technical Support".

Cat. No. RP10769
Size
Price
0.5 mg $90.00