Synonyms | Exendin4exenatide; Byetta |
Description | Exendin-4 is a 39-amino acid peptide amide. Exendin-4, like Exendin-3, stimulates an increase in acinar cAMP without stimulating the release of amylase. Exendin-4 is a long-acting potent agonist of the glucagon-like peptide 1 (GLP-1). Exendin-4 is the active component of Byetta (exenatide) injection, which may improve glycemic control in people with type 2 diabetes mellitus and has the potential to reduce plasma glucose at least partly by a delay in gastric emptying as well as by reducing calorie intake. Exendin-4 enhances glucose-dependent insulin secretion by the pancreatic β-cell and suppresses inappropriately elevated glucagon secretion. |
Cas No | 141758-74-9 |
Sequence | {HIS}{GLY}{GLU}{GLY}{THR}{PHE}{THR}{SER}{ASP}{LEU}{SER}{LYS}{GLN}{MET}{GLU}{GLU}{GLU}{ALA}{VAL}{ARG}{LEU}{PHE}{ILE}{GLU}{TRP}{LEU}{LYS}{ASN}{GLY}{GLY}{PRO}{SER}{SER}{GLY}{ALA}{PRO}{PRO}{PRO}{SER}-NH2 |
Sequence Shortening | HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
Molecular Formula | C184H282N50O60S |
C Terminal | NH2 |
Molecular Weight | 4186.66 |
Purity | > 95% |
Solubility | Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents. |
Gmp Flag | 0 |
Anaspec Cat No | His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 |
Storage | Store the peptide at -20°C. |
Note | This peptide interacts interacts with exendin receptor to increase pancreatic acinar cAMP. It has no secretagogue activity and does not bind to VIP receptors. |
Cat. No. |
Product Name |
Price |
|
---|---|---|---|
RP10872-0.5 |
Exendin (9-39) - 0.5 mg |
$138.00 |
For more documents, please visit "Technical Support".