• English
  • Sign In
  • Contact Us
×
Catalog Products » Calcitonin, salmon

Calcitonin, salmon

Synonyms Thyrocalcitonin
Description Calcitonin (salmon) is an hypocalcemic hormone produced by the parafollicular C cells of the thyroid or by the ultimobranchial bodies of nonmammalian vertebrates. Calcitonin decreases blood calcium and phosphate due to inhibition of resorption by osteoblasts and osteocytes. Calcitonin contains a single disulfide bond, which causes the amino terminus to assume the shape of a ring. Alternative splicing of the calcitonin pre-mRNA can yield a mRNA encoding calcitonin gene-related peptide; that peptide appears to function in the nervous and vascular systems. The calcitonin receptor has been cloned and shown to be a member of the seven-transmembrane, G protein-coupled receptor family.
Cas No 47931-85-1
Sequence
{CYS}{SER}{ASN}{LEU}{SER}{THR}{CYS}{VAL}{LEU}{GLY}{LYS}{LEU}{SER}{GLN}{GLU}{LEU}{HIS}{LYS}{LEU}{GLN}{THR}{TYR}{PRO}{ARG}{THR}{ASN}{THR}{GLY}{SER}{GLY}{THR}{PRO}-NH2
Sequence Shortening CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2
Molecular Formula C145H240N44O48S2
C Terminal NH2
Disulfide Bridge Disulfide bridge: Cys1-Cys7
Molecular Weight 3431.9

Purity > 95%
Format Bridge 1-7
Solubility Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
Gmp Flag 0
Storage Store at -20°C.
Note Calcitonin is a 32 amino acid polypeptide, 8 of which are conserved across all species.

  • Calcitonin, Salmon
  • Calcitonin, Salmon


Cat. No.
Product Name
Price
RP13606
Calcitonin (8-32), salmon - 0.2 mg
$138.00
RP12786-5
Calcitonin, eel - 5 mg
$451.00
RP11095-0.5
Calcitonin Gene Related Peptide (CGRP), rat - 0.5 mg
$128.00
RP11092-0.5
Calcitonin Gene Related Peptide (CGRP) II, rat - 0.5 mg
$119.00
RP11090-0.5
Calcitonin Gene Related Peptide (CGRP) (8-37), rat - 0.5 mg
$90.00
RP11089-0.5
Calcitonin Gene Related Peptide (CGRP) (8-37), human - 0.5 mg
$90.00
 
Ofluoglu D, et al. Early effect of nasal salmon calcitonin on the bone marker Crosslaps. Rheumatol. Int. Feb 2006; 26(4): 288-291.

Sahin F, et al. Efficacy of salmon calcitonin in complex regional pain syndrome (type 1) in addition to physical therapy. Clin. Rheumatol. Mar 2006; 25(2): 143-148.

Schweitzer-Stenner R, et al. Salmon calcitonin and amyloid beta: two peptides with amyloidogenic capacity adopt different conformational manifolds in their unfolded states. Biochemistry. Mar 2006; 45(9): 2810-2819.

You can visit "Citations Database" for more citations.







For more documents, please visit "Technical Support".

Cat. No. RP11099
Size
Price
0.5 mg $57.00