• English
  • Sign In
  • Contact Us
×
Home » Gene Synthesis & Molecular Biology Services » Adrenomedullin (AM) (22-52), human

Adrenomedullin (AM) (22-52), human

Description Adrenomedullin (ADM) is a 52-aa hypotensive peptide. Adrenomedullin (ADM) has structural similarity with amylin. ADM is produced in peripheral tissues, adrenal medulla, lung, and kidney. ADM has specific receptors on astrocytes and it is unregulated in ischaemia.
Cas No 159899-65-7
Sequence
{THR}{VAL}{GLN}{LYS}{LEU}{ALA}{HIS}{GLN}{ILE}{TYR}{GLN}{PHE}{THR}{ASP}{LYS}{ASP}{LYS}{ASP}{ASN}{VAL}{ALA}{PRO}{ARG}{SER}{LYS}{ILE}{SER}{PRO}{GLN}{GLY}{TYR}-NH2
Sequence Shortening TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
Molecular Formula C159H252N46O48
C Terminal NH2
Molecular Weight 3576.1

Purity > 95%
Solubility Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
Storage Before using, store the peptide in the DRY form at - 20°C. For best and repeatable results, rehydrate the peptide immediately before using. Do not re-freeze any unused portions.
Note


Cat. No.
Product Name
Price
RP11291-0.5
Adrenomedullin (AM) (13-52), human - 0.5 mg
$214.00
RP11288-0.5
Adrenomedullin (AM) (1-52), human - 0.5 mg
$261.00
 
Ross GR, Yallampalli C. Endothelium-Independent Relaxation by Adrenomedullin in Pregnant Rat Mesenteric Artery: Role of cAMP-Dependent Protein Kinase A and Calcium-Activated Potassium Channels. J. Pharmacol. Exp. Ther. Jun 2006; 317(3): 1269-1275.

Hashimoto H, et al. Centrally administered adrenomedullin 2 activates hypothalamic oxytocin-secreting neurons, causing elevated plasma oxytocin level in rats. Am. J. Physiol. Endocrinol. Metab. Nov 2005; 289(5): E753-E761.

You can visit "Citations Database" for more citations.







For more documents, please visit "Technical Support".

Cat. No. RP11293
Size
Price
0.5 mg $90.00