Description | Adrenomedullin (ADM) is a 52-aa hypotensive peptide. Adrenomedullin (ADM) has structural similarity with amylin. ADM is produced in peripheral tissues, adrenal medulla, lung, and kidney. ADM has specific receptors on astrocytes and it is unregulated in ischaemia. |
Cas No | 159899-65-7 |
Sequence | {THR}{VAL}{GLN}{LYS}{LEU}{ALA}{HIS}{GLN}{ILE}{TYR}{GLN}{PHE}{THR}{ASP}{LYS}{ASP}{LYS}{ASP}{ASN}{VAL}{ALA}{PRO}{ARG}{SER}{LYS}{ILE}{SER}{PRO}{GLN}{GLY}{TYR}-NH2 |
Sequence Shortening | TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 |
Molecular Formula | C159H252N46O48 |
C Terminal | NH2 |
Molecular Weight | 3576.1 |
Purity | > 95% |
Solubility | Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. |
Storage | Before using, store the peptide in the DRY form at - 20°C. For best and repeatable results, rehydrate the peptide immediately before using. Do not re-freeze any unused portions. |
Note |
Cat. No. | Product Name | Quantity | Price |
---|---|---|---|
RP11291-0.5 |
Adrenomedullin (AM) (13-52), human - 0.5 mg |
$214.00 |
|
RP11288-0.5 |
Adrenomedullin (AM) (1-52), human - 0.5 mg |
$261.00 |
For more documents, please visit "Technical Support".