Catalog Products »
Adrenocorticotropic Hormone (ACTH) (1-39), rat
Adrenocorticotropic Hormone (ACTH) (1-39), rat
| Synonyms | ACTH (1-39), ratAdrenocorticotropic hormone, rat |
| Description | Peptide fragments of ACTH (1-39) were formed during in vitro incubation of the peptide with membrane preparations. ACTH (1-39) were isolated by high pressure liquid chromatography, and peptide fragments of ACTH (1-39) characterized by determination of amino acid composition and NH2- terminal residue. |
| Cas No | 77465-10-2 |
| Sequence | {SER}{TYR}{SER}{MET}{GLU}{HIS}{PHE}{ARG}{TRP}{GLY}{LYS}{PRO} {VAL}{GLY}{LYS}{LYS}{ARG}{ARG}{PRO}{VAL}{LYS}{VAL}{TYR}{PRO} {ASN}{VAL}{ALA}{GLU}{ASN}{GLU}{SER}{ALA}{GLU}{ALA}{PHE}{PRO} {LEU}{GLU}{PHE} |
| Sequence Shortening | SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF |
| Molecular Formula | C210H315N57O57S1 |
| Molecular Weight | 4582.5 |
| Purity | > 95% |
| Solubility | Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. |
| Gmp Flag | 0 |
| Storage | Before using, store the peptide in the DRY form at 0-5°C. For best and repeatable results, rehydrate the peptide immediately before using. Do not re-freeze any unused portions. |
| Note |
Mi-Sun Yum., etc. Prenatal stress promotes development of spasms in infant rats. Epilepsia. 2012 Mar;53(3):e46-9.
You can visit "Citations Database" for more citations.
You can visit "Citations Database" for more citations.
For more documents, please visit "Technical Support".
| Cat. No. RP11305 | ||
|---|---|---|
| Size | Price | |
| 0.5 mg | $90.00 | |
