Catalog Products » SARS-CoV-2 Spike Glycoprotein RBD B.1.1.7-Alpha

SARS-CoV-2 Spike Glycoprotein RBD B.1.1.7-Alpha

This pool is delivered in one pool of 53 peptides derived from a peptide scan (15mers with 11 aa overlap) through Spike glycoprotein - Receptor binding domain (mutation: N501Y) of SARS-CoV-2 (Severe Acute Respiratory Syndrome-related coronavirus 2) for T cell assays (e.g. ELISPOT).
RP30026
$327.00

Ask us a question
Overview
Description This pool is delivered in one pool of 53 peptides derived from a peptide scan (15mers with 11 aa overlap) through Spike glycoprotein - Receptor binding domain (mutation: N501Y) of SARS-CoV-2 (Severe Acute Respiratory Syndrome-related coronavirus 2) for T cell assays (e.g. ELISPOT).
Sequence
RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFK
CYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNS
NNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQ
PTYGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF

Properties
Source Severe Acute Respiratory Syndrome-related coronavirus 2 (Lineage B.1.1.7) Spike glycoprotein - Receptor binding domain (covering the following mutation: N501Y).
Gene ID S
Length 223 aa
Purity Crude (Major peak by ESI-MS is guaranteed to be peptide of interest - determined at 220 nm for each individual peptide).
Form Lyophilized
Storage Store at -20°C.
Note The peptides of this product are supplied as trifluoroacetate salts.

Do you like the current new website?

Hate

Dislike

Neutral

Like

Love

*