Description |
This pool is
delivered in one pool of 53 peptides derived from a peptide scan (15mers with
11 aa overlap) through Spike glycoprotein - Receptor binding domain (mutation:
N501Y) of SARS-CoV-2 (Severe Acute Respiratory Syndrome-related coronavirus 2)
for T cell assays (e.g. ELISPOT). |
Sequence |
RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFK CYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNS NNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQ PTYGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF |
Source |
Severe Acute
Respiratory Syndrome-related coronavirus 2 (Lineage B.1.1.7) Spike glycoprotein
- Receptor binding domain (covering the following mutation: N501Y). |
Gene ID |
S |
Length |
223 aa |
Purity |
Crude (Major peak by
ESI-MS is guaranteed to be peptide of interest - determined at 220 nm for each
individual peptide). |
Form | Lyophilized |
Storage | Store at -20°C. |
Note | The peptides of this product are supplied as trifluoroacetate salts. |
For more documents, please visit "Technical Support".