• English
  • Sign In
  • Contact Us
×
Catalog Products » Recombinant Proteins » Hormones » Exendin-4 

Exendin-4 

Synonyms Exendin-4 ;
Description Exendin-4 is a novel 39-amino acid peptide isolated from the venom of the Gila monster Heloderma suspectum. It shares 53% sequence homology with GLP-17-36amide and interacts with the same membrane receptor. Exendin-4 enhances glucose-dependent insulin secretion, suppresses inappropriately elevated glucagon secretion, and slows gastric emptying in vivo. It also promotes ß-cell proliferation and neogenesis in vitro and in animal models. Recombinant Exendin-4 is E. coli expression of a synthetic DNA squence encoding the 39 amino acid of Exendin-4.
Source E. coli
Biological Activity 1. Regulates Glucose levels rapidly
2. Reduces Insulin resistence
3. Reduces Glucagon
4. Reduces HbA1c
5. Stimulates beta cell growth which stimulates insulin production.
Sequence
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Measured Molecular Weight Approximately 4.2 kDa, a single non-glycosylated polypeptide chain containing 39 amino acids.
Purity >96% by SDS-PAGE and HPLC analyses.
Formulation Lyophilized from a 0.2 μm filtered solution in PBS, pH 7.4.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 °C. Further dilutions should be made in appropriate buffered solutions.
Endotoxin Level Less than 0.2EU/ug of rExendin-4 as determined by LAL method.
Physical Appearance Sterile Filtered White lyophilized (freeze-dried) powder.
Usage This material is for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE.
Storage This lyophilized preparation is stable at 2-8 °C, but should be kept at -20 °C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 °C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 °C to -70 °C. Avoid repeated freeze/thaw cycles.
Note ;




Notice there is no results found, you can visit "Citations Database" for other results.







For more documents, please visit "Technical Support".

Cat. No. Z02811
Size
Price
100 ug $159.00
1 mg $425.00