For each citation that was shared on social media (LinkedIn, Facebook, or Twitter) with the “@GenScript” tag, the author will be rewarded with a $10 Amazon gift card or 2,000 GS points.
Citations Search |
- Acta Biomaterialia 2020-03;
Collagen hydrogel confinement of amyloid-β accelerates aggregation and reduces cytotoxic effects
Products/Services Used | Details | |
---|---|---|
![]() |
… (1-42) (Scr Aβ) 102 (AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA) was purchased from AnaSpec (Fremont, CA) 103 and Genscript (Piscataway, NJ) HiLyte 488-labeled Aβ (1-42) (HiLyte Aβ) and FAM-labeled scrambled Aβ 104 … | |
AbstractAlzheimer's disease (AD) is the most common form of dementia and is associated with the accumulation of amyloid-β (Aβ), a peptide whose aggregation has been associated with neurotoxicity. Drugs targeting Aβ have shown great promise in 2D in vitro models and mouse models, yet preclinical and clinical trials for AD have been highly disappointing. We propose that current in vitro culture systems for discovering and developing AD drugs have significant limitations; specifically, that Aβ aggregation is vastly different in these 2D cultures carried out on flat plastic or glass substrates vs. in a 3D environment, such as brain tissue, where Aβ confinement alters aggregation kinetics and thermodynamics. In this wo... More KeywordsMost Popular Services |