Resources » Reference Databases » Citations Database
Products/Services Used | Details | Operation |
---|---|---|
Proteins, Expression, Isolation and Analysis> | The Ty3 NCp9 protein (57 amino acids: TVRTRRSYNKPMSNHRNRRNNNPSREECIKNRLCFYCKKEGHRLNECRARKASSNRS) was prepared by chemical synthesis and purified by high-performance liquid chromatography (HPLC) (GenScript). | Get A Quote |
Long terminal repeat (LTR)-retrotransposons are significant contributors to the evolution and diversity of eukaryotic genomes. Their RNA genomes (gRNA) serve as a template for protein synthesis and reverse transcription to a DNA copy, which can integrate into the host genome. Here, we used the SHAPE-MaP strategy to explore Ty3 retrotransposon gRNA structure in yeast and under cell-free conditions. Our study reveals the structural dynamics of Ty3 gRNA and the well-folded core, formed independently of the cellular environment. Based on the detailed map of Ty3 gRNA structure, we characterized the structural context of cis-acting sequences involved in reverse transcription and frameshifting. We also identified a no... More