For each citation that was shared on social media (LinkedIn, Facebook, or Twitter) with the “@GenScript” tag, the author will be rewarded with a $10 Amazon gift card or 2,000 GS points.

An Integrated Whole-Process Repair System with Programmed Regulation of Healing Performance Facilitates Urethral Wound Restoration and Scarless Reconstruction

Adv Sci (Weinh). 2024-12; 
Wenzhuo Fang , Ying Wang , Kaile Zhang , Ming Yang , Meng Liu , Yangwang Jin , Xianjie Xiu , Yuhui Wang , Zhenwei Yu , Ranxing Yang , Qiang Fu
Products/Services Used Details Operation
Peptide Synthesis The LL37 antimicrobial peptide ([LL-37, 37 aa]) was synthesized with the help of GenScript Biotech Corporation (Nanjing, China) with purities greater than or equal to 98%. Get A Quote

Abstract

The harsh microenvironment of the urethral injury often carries high risks of early undesirable healing as well as late scar tissue formation. Indeed, the infection and inflammatory response in the early stages as well as blood vessel formation and tissue regeneration in the later stages fundamentally impact the outcomes of urethral wound healing. Innovatively, an integrated whole-process repair hydrogel (APF/C/L@dECM) is designed. After rigorous testing, it is found that hydrogels formed by hydrophobic association and double cross-linking of amide bonds can procedurally regulate wound healing in all phases to match the repair process. In rabbit models of urethral wound, APF/C/L@dECM hydrogel can achieve scarle... More

Keywords

hydrogel; scarless reconstruction; tissue engineering; urethral injury; whole‐process repair. © 2024 The Author(s). Advanced Science published by Wiley‐VCH GmbH.