GenScript Home GenScript Home
  • SIGN IN
    • My Account
    • Sign Out
  • EN
    • CN
    • JP
  • BRANDS
    • Legend Biotech
    • ProBio
    • Bestzyme
  • CONTACT US
HOME
  • REAGENT SERVICES
    • Most Popular Services
    • Molecular Biology
    • Mutation and Library Services
    • Oligo Synthesis
    • Peptide Synthesis
    • CRISPR/Cas9 Genome Editing
    • Protein Expression
    • Antibody Services
    • Cell Engineering
      • TurboCHO™ High Throughput Services as fast as 2 weeks
      • TurboCHO™ Recombinant Expression System Upgraded
      • MonoRab™ Rabbit mAb
      • Anti-idiotype Antibody Services New!
      • Neoantigen Peptide Service New!
      • CRISPR sgRNA Services
      • Gene Synthesis
      • Gene to Lentivirus One Stop Package New!
      • IVT mRNA Production as fast as 2 weeks
      • Gene Synthesis
      • GenSmart
      • Subcloning and cloning
      • Plasmid prep
      • Custom Vector Construction Services
      • ORF
      • IVT mRNA Production New!
      • GenCircle™ Double-Stranded DNA New!
      • Gene Variant Libraries
      • Site-Directed Mutagenesis Service
      • HTP Site-Directed Mutagenesis Service
      • Precision Mutant Libraries
      • High-Throughput DNA Library Assembly Service
      • Custom DNA Oligo
      • Custom RNA Oligo
      • qPCR Oligos New!
      • Precise Synthetic Oligo Pools
      • GenTitan Oligo Pool
      • SARS-CoV-2 RT-qPCR Primers & Probes New!
      • NGS Target Enrichment
      • Custom Peptide Synthesis
      • Peptide Library
      • Neoantigen Peptide
      • Peptide Modification
      • AccuPep+ QC
      • Peptide Technology & Resource
      • Peptide Applications
      • CRISPR Plasmids
      • Synthetic sgRNA Services New!
      • HDR Template New!
      • CRISPR gRNA Plasmid Library
      • CRISPR Cell Engineering
      • Microbial Genome Editing
      • Reagents for COVID-19 Research
      • TurboCHO Antibody Expression New!
      • Bacterial Expression
      • Insect Expression
      • Mammalian Expression
      • COVID-19 Reagent Antibodies
      • Polyclonal Antibody Services
      • Monoclonal Antibody Services
      • Anti-idiotype Antibody Services New!
      • Antibody Production Services
      • Specialized Antibody Services
      • Custom ELISA Kit Generation
      • Research Grade Lentiviral Vector Packaging New!
      • Stable Cell Line (CellPower™) for Assay Development
      • CRISPR Cell Line Development
      • Gene to Lentivirus One Stop Package New!
    • Proteins for COVID-19 Research Proteins for COVID-19 Research
    • Gene
                      Synthesis Gene Synthesis
    • High-Throughput
                        DNA Library
                        Assembly High-Throughput DNA Library Assembly
    • qPCR Oligos qPCR Oligos
    • Peptide
                      Synthesis Services Peptide Synthesis Services
    • CRISPR Plasmids CRISPR Plasmids
    • Bacterial
                      Expression Bacterial Expression
    • Custom
                      Monoclonal
                      Antibodies Custom Monoclonal Antibodies
    • CellPower™
                      Assay
                      Cell Line
                      Development CellPower™ Assay Cell Line Development
  • DIAGNOSTICS Hot!
    • Monkeypox
    • COVID-19
    • cPass™ Technology
    • Rapid Tests
    • Resource
    • News
      • Monkeypox Research and Diagnostic Tools
      • cPass Technology
      • Rapid Tests
      • SARS-CoV-2 Surrogate Virus Neutralization Test (sVNT) Kit (RUO)
      • cPass™ SARS-CoV-2 Neutralization Antibody Detection Kit (FDA EUA)
      • cPass™ SARS-CoV-2 Neutralization Antibody Detection Kit (CE)
      • cPass™ SARS-CoV-2 Neutralization Antibody Detection Kit (HSA)
      • SARS-CoV-2 Antigen Rapid Test
      • SARS-CoV-2 Neutralizing Antibody Rapid Test
      • Webinars
      • Citations
      • FAQs
      • Distributors
      • Service Partners
      • Company
      • Media
    • Monkeypox Research and Diagnostic Tools Monkeypox Research and Diagnostic Tools
    •  
    • SARS-CoV-2 Surrogate Virus Neutralization Test (sVNT) Kit (RUO) SARS-CoV-2 Surrogate Virus Neutralization Test (sVNT) Kit (RUO)
    • SARS-CoV-2
                      Antigen Rapid Test SARS-CoV-2 Antigen Rapid Test
    • Webinars Webinars
    • Company Company
  • PRODUCTS
    • Most Popular Products
    • CRISPR Gene Editing
    • Antibodies and Immunodetection
    • Protein Electrophoresis and Blotting
    • Protein Purification
    • Proteins and Peptides
    • Molecular Biology
    • Stable Cell Lines
    • Cell Therapy
    • Product Resource & Support
      • Hot New Product
      • Automated Plasmid PurificationNew!
      • COVID-19 Products
      • Claudin 18.2 Proteins & Stable Cell Lines
      • Immune Checkpoint Antibodies and Proteins
      • Cas9 / Cas12a / Cas13a Nucleases
      • GMP Cas9 Nucleases
      • CRISPR sgRNA Synthesis
      • HDR Knock-in Template
      • CRISPR Gene Editing Kits and Antibodies
      • Anti-VHH Antibodies
      • Anti-idiotype Antibodies
      • Epitope Tag Antibodies
      • Rabbit Monoclonal Antibodies
      • Primary Antibodies
      • Immunodetection
      • IVD Antibodies
      • Precast Gels
      • Cell Lysates
      • Protein Standards
      • GenBox Mini Electrophoresis Tank
      • eBlot™ L1 Protein Transfer System
      • eStain™ L1 Protein Staining System
      • eZwest™ Automated Western Device
      • Protein Purification Resins
      • Magnetic Beads
      • Magnetic Racks
      • AmMag™ Magnetic Bead
      • AmMag™ SA Plus semi automated system
      • Endotoxin Detection and Removal
      • Cytokines
      • Growth Factors
      • Immune Checkpoints
      • Tag Cleavage Enzymes
      • Peptides
      • Automated Plasmid PurificationNew!
      • Lentivirus Titer p24 ELISA KitNew!
      • AAV2 Titer Caspid ELISA KitNew!
      • PCR Reagents
      • DNA Assembly
      • IVT mRNA Reagents
      • S. marcescens Nuclease
      • GenScript DNA-Encoded Chemical Library Kit – GenDECL™
      • ACE2 and Spike Protein Cell Lines
      • Immune Checkpoint Cell Lines
      • Fc Receptor Cell Lines
      • GPCR Stable Cell Lines
      • Cell Isolation
      • Cell Activation
      • Automated Cell IsolationNEW!
      • Cell Manual IsolationNEW!
      • Quick Order
      • Product Promotions
      • Products FAQs
      • Products COAs, SDS
      • Flyer & Brochure
      • Product Citations
    • COVID-19 Products COVID-19 Products
    • Cas
                      Nucleases Cas Nucleases
    • Anti-Camelid
                      VHH Anti-Camelid VHH
    • Precast Gels Precast Gels
    • Protein
                      Isolation &
                      Purification Protein Isolation & Purification
    • Recombinant Cytokines Recombinant Cytokines
    • PCR
                      Reagents PCR Reagents
    • ACE2 / Spike
                      Protein ACE2 / Spike Protein
    • Cell Isolation Cell Isolation
    • Quick
                      Order Quick Order
    • Endotoxin
                      Detection &
                      Removal
                      System Endotoxin Detection & Removal System
  • APPLICATIONS
    • We Recommend
    • Life Science Research
    • Key Market Segments
    • Case Study
      • Gene and Cell Therapy New
      • Antibody Drug Discovery New
      • Synthetic Biology
      • Protein Biology
      • Plant Biology
      • Genome Editing
      • Synthetic Biology
      • Protein Biology
      • Plant Biology
      • Genome Editing
      • Protein Isolation and Analysis
      • Immuno-oncology
      • Western Blotting New!
      • Gene Therapy
      • Vaccine Development
      • Immunotherapy
      • Drug Discovery & Development
      • SC2.0
    • Gene and Cell Therapy Gene and Cell Therapy
    • Synthetic Biology Synthetic Biology
    • Gene Therapy Solution
    • SC2.0 SC2.0
  • RESOURCES
    • Promotions
    • One Stop Solutions
    • Technical Resource Centers
    • Bioinformatics Tools
    • Learning Center
    • GenScript Reward Program
    • Reference Databases
    • GenScript Referral Program
    • Others
      • Service Promotions
      • Product Promotions
      • Biopharmaceutical Research and Development New
      • Molecular Biology Resource Center
      • Peptide Resource Center
      • Protein Resource Center
      • Antibody Resource Center
      • CRISPR Resource Center
      • Product Resources Center
      • Synthetic Biology Resource Center
      • Molecular Biology Tools
      • CRISPR Tools
      • Peptide Tools
      • Protein Tools
      • Brochures & Flyers
      • FAQ
      • Handbooks
      • News & Blogs
      • Case Studies New!
      • Expert's Insight New!
      • Research Digest
      • Podcast
      • Research News Highlights
      • Service & Product Documentation
      • Webinars
      • GenScript Reward Program
      • Peer-Reviewed Citations
      • ORF and Mutant Clones
      • Antigen- Peptide Database
      • CRISPR gRNA database
      • GenScript Referral Program
      • Privacy Policy
      • Standard Terms & Conditions
      • Distributors
    •  
    • Antibody Drug Discovery Antibody Drug Discovery
    • Gene Resource
                        Center Molecular Biology Resource Center
    • Molecular Biology Tools Molecular Biology Tools
    • Brochures & Flyers Brochures & Flyers
    • GenScript
                        Reward Program GenScript Reward Program
    • Peer-Reviewed-Citations Peer-Reviewed Citations
    • GenScript
                        Referral
                        Program GenScript Referral Program
    • Privacy
                        Policy Privacy Policy
  • INVESTORS
  • GROUP
    • Who We Are
    • What We Do
    • Company News
    • Careers
    • Report Fraud and Corruption
    • Paperless Program
    • Contact Us
      • Group Overview
      • Our Culture
      • Advisory Board
      • Our Commitment
      • Company Awards
      • For Academia
      • For Industry
      • Customer Testimonials
      • Press Releases
      • Events
      • Latest Citations
      • Social Responsibility
      • Open Positions
      • Report Fraud and Corruption
      • Paperless Program
      • Contact Us
    • Company
                      Overview Group Overview
    • For
                      Academia For Academia
    • Press
                      Releases Press Releases
    • Open Positions Open Positions
    • Report Fraud and
                      Corruption Report Fraud and Corruption
    • Paperless
            Program Paperless Program
    • Contact Us Contact Us
  • ABOUT US
  • SIGN IN My Account SIGN OUT
Quick Order

All Results

Product Group
Product Line
Target
Application
Host Species
Conjugate
Clonality

Google Result

1 results for SUMO Tag Sort By

Filtered by

Filters

Clear all

SUMO-tag Antibody(4G11E9), mAb, Mouse

1 Citations

  • Application :
    ELISA; WB;
  • Isotype :
    Mouse IgG2a,κ
  • Conjugate :
    Unconjugated
  • Immunogen :
    Purified recombinant yeast SUMO protein (DSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDG             IRIQADQAPEDLDMEDNDIIEAHREQIGG)
  • Image:

    [2 Images]

size price quantity
$102
  • « Previous
  • 1
  • Next »
Next-day Shipping ORF Clones ( in default vector with tag)
1 Clone 30% OFF
2-4 Clone 40% OFF
5 or more Clone 50% OFF
All Other ORF Clones
30% OFF
Promotional price is subject to Terms and Conditions

Free Sample

Promotion Codes & Coupons

Quick Order

Resource Center

Get Support

China

No. 28 Yongxi Road, Jiangning District, Nanjing, Jiangsu, China 211100

United Kingdom

Unit 9, Kings Meadow, Ferry Hinksey Rd, Oxford OX2 0DP

USA

860 Centennial Ave. Piscataway NJ
08854

EU Headquarter

Treubstraat 1, 1st floor. 2288EG, Rijswijk, Netherlands.

SUPPORT

  • Bioinformatics Tools
  • Quick Order
  • Reward Center
  • Contact Us
  • FAQ

COMPANY

  • About Us
  • Social Media
  • Careers
  • Sitemap
Singapore

164 Kallang Way, #06-12, Singapore 349248

Japan

ジェンスクリプトジャパン株式会社 〒101-0042 東京都千代田区神田東松下町48 ism神田4F

Korea

10 FL , 21, Teheran-ro 8-gil, Gangnam-gu, Seoul, Republic of Korea (06234)

SUPPORT

  • Bioinformatics Tools
  • Quick Order
  • Reward Center
  • Contact Us

COMPANY

  • About Us
  • Social Media
  • Careers
  • Sitemap

  • © 2002-2023 GenScript All rights reserved.
  • |
  • 苏ICP备15037624号-4
  • |
  • Site Map
  • |
  • Terms of Use and Privacy