Neuropeptide Y(1-36)
| RP20520 | |
|
|
|
|
|
|
| Ask us a question | |
IVD Raw Materials
| RP20520 | |
|
|
|
|
|
|
| Ask us a question | |
Neuropeptide Y (NPY) is a vasoconstrictor and a brain peptide that inhibits Ca2+-activated K+ channels in vascular smooth muscle. Neuropeptide Y (NPY) is implicated in the control of blood pressure, sexual behavior, and food intake. Neuropeptide Y (NPY) inhibits cholecystokinin- and secretin-stimulated pancreatic secretion. |
Neuropeptide Y(1-36)
| Sequence |
{Tyr}{Pro}{Ser}{Lys}{Pro}{Asp}{Asn}{Pro}{Gly}{Glu}{Asp}{Ala} {Pro}{Ala}{Glu}{Asp}{Met}{Ala}{Arg}{Tyr}{Tyr}{Ser}{Ala}{Leu} {Arg}{His}{Tyr}{Ile}{Asn}{Leu}{Ile}{Thr}{Arg}{Gln}{Arg}{Tyr} |
| Sequence Shortening | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY |
| Molecular Formula | C189H284N54O58S1 |
| Molecular Weight | 4272.7 |
| Purity | > 95% |
| Storage | Store the peptide at -20°C. |