Catalog Products » Recombinant Proteins » Pigment Epithelium-derived Factor ( PEDF), Human
GenScript Share
 
Search by Catalog Number :
Search by Name :
Search by Sequence : (One letter code)
Search by Category :



Pigment Epithelium-derived Factor ( PEDF), Human



Cat. No.
Name
Size   
Price
Selected
Z02722-1
1 mg
$3,120
Z02722-20
20 μg
$157

Full Name Pigment Epithelium-Derived Factor ( PEDF), Human
Abbreviated Name-1
 
Documents
Pigment Epithelium-derived Factor ( PEDF), HumanDocument-MSDS: 15186_20111231010432.PDF (PDF)
Pigment Epithelium-derived Factor ( PEDF), HumanDocument-COA: Z02722_R50381204.pdf (pdf)
Pigment Epithelium-derived Factor ( PEDF), HumanDocument-COA: C51471305_Z02722_COA.pdf (PDF)
Figures
Reference
Description
PEDF is a noninhibitory serpin with neurotrophic, anti-angiogenic, and anti-tumorigenic properties. It is a 50 kDa glycoprotein produced and secreted in many tissues throughout the body. A major component of the anti-angiogenic action of PEDF is the induction of apoptosis in proliferating endothelial cells. In addition, PEDF is able to inhibit the activity of angiogenic factors such as VEGF and FGF-2. The neuroprotective effects of PEDF are achieved through suppression of neuronal apoptosis induced by peroxide, glutamate, or other neurotoxins. The recent identification of a lipase-linked cell membrane receptor for PEDF (PEDF-R) that binds to PEDF with high affinity should facilitate further elucidation of the underlying mechanisms of this pluripotent serpin. To date, PEDF-R is the only signaling receptor known to be used by a serpin family member. The unique range of PEDF activities implicate it as a potential therapeutic agent for the treatment of vasculature related neurodegenerative diseases such as age-related macular degeneration (AMD) and proliferative diabetic retinopathy (PDR). PEDF also has the potential to be useful in the treatment of various angiogenesis-related diseases including a number of cancers.
Source
Escherichia coli.
M.W.
Approximately 44.5 KDa, a single non-glycosylated polypeptide chain containing 400 amino acids.
Purity
>95% by SDS-PAGE and HPLC analyses.
Endotoxin Level
Less than 0.2EU/ug of rHuPEDF as determined by LAL method.
Storage
This lyophilized preparation is stable at 2-8 °C, but should be kept at -20 °C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 °C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 °C to -70 °C. Avoid repeated freeze/thaw cycles.
Formulation
Lyophilized from a 0.2µm filtered concentrated solution in 20mM PB, pH7.4, 150mM NaCl.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 °C. Further dilutions should be made in appropriate buffered solutions.
Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Usage
This material is for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE.
Sequence

MQNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRSSMSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHGTYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLPLKVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRAGFEWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGP
1
Custom Recombinant Protein Services: Guaranteed E. coli Expression Package-3 mg purified soluble protein from $2,200 .
2
Bacterial Expression System: GenScript has developed BacPowerTM technologies to tackle hard-to-express and hard-to-dissolve proteins.
3
Yeast Expression System: GenScript's proprietary YeastHIGHTM technology combines the advantages of the bacterial and eukaryotic expression systems.
4
Baculovirus/Insect Cell Expression System: GenScript developed BacuVanceTM platform for the secretion of recombinant proteins from baculovirus-infected insect cells.
5
Mammalian Cell Expression System: The proprietary 293 and CHO suspension system platform promotes fast production and delivery of recombinant proteins and monoclonal antibodies up to grams level.