| Full Name |
NAP-2 /CXCL7, Human
|
Abbreviated Name-1 |
NAP-2 /CXCL7, Human; |
|
Description |
Neutrophil Activating Peptide 2 (NAP-2) is proteolytically processed carboxyl-terminal fragments of platelet basic protein (PBP) which is found in the alpha-granules of human platelets. NAP-2 is a member of the CXC chemokines. Similar to other ELR domain containing CXC chemokines such as IL-8 and the GRO proteins, NAP-2 has been shown to bind CXCR-2 and to chemoattract and activate neutrophils. Although CTAP-III, ß-TG and PBP represent amino-terminal extended variants of NAP-2 and possess the same CXC chemokine domains, these proteins do not exhibit NAP-2 activity. Recently, it has been shown that the additional amino-terminal residues of CTAP-III masks the critical ELR receptor binding domain that is exposed on NAP-2 and may account for lack of NAP-2 activity. |
Source |
Escherichia coli. |
M.W. |
7.6 kDa, a single non-glycosylated polypeptide chain containing 70 amino acids. |
Purity |
>97% by SDS-PAGE and HPLC analyses. |
Endotoxin Level |
Less than 0.2EU/ug of rHuNAP-2/CXCL7 as determined by LAL method. |
Specific Activity |
Fully biologically active when compared to standard. The ED50 determined by a chemotaxis bioassay using human peripheral blood neutrophils is less than 10 ng/ml, corresponding to a specific activity of ＞ 1.0 × 105 IU/mg. |
Storage |
This lyophilized preparation is stable at 2-8 °C, but should be kept at -20 °C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 °C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 °C to -70 °C. Avoid repeated freeze/thaw cycles. |
Formulation |
Lyophilized from a 0.2µm filtered concentrated solution in 20mM PB, pH 7.4, 50mM NaCl. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 °C. Further dilutions should be made in appropriate buffered solutions. |
Physical Appearance |
Sterile Filtered White lyophilized (freeze-dried) powder. |
Usage |
This material is for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. |
Sequence |
AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD |
Document-MSDS: 15342_20120105031128.PDF (PDF)