| Full Name |
MIG/CXCL9, Human
|
Abbreviated Name-1 |
MIG/CXCL9, Human; |
|
Description |
CXCL9, a member of the ª subfamily of chemokines that lack the ELR domain, was initially identified as a lymphokine-activated gene in mouse macrophages. The CXCL9 gene is induced in macrophages and in primary glial cells of the central nervous system specifically in response to IFN-γ. CXCL9 has been shown to be a chemoattractant for activated T-lymphocytes and TIL but not for neutrophils or monocytes. The human CXCL9 cDNA encodes a 125 amino acid residue precursor protein with a 22 amino acid residue signal peptide that is cleaved to yield a 103 amino acid residue mature protein. CXCL9 has an extended carboxy-terminus containing greater than 50% basic amino acid residues and is larger than most other chemokines. A chemokine receptor (CXCR3) specific for CXCL9 and IP-10 has recently been cloned and shown to be highly expressed in IL-2-activated T-lymphocytes. |
Source |
Escherichia coli. |
M.W. |
11.7 kDa, a single non-glycosylated polypeptide chain containing 103 amino acids. |
Purity |
>97% by SDS-PAGE and HPLC analyses. |
Endotoxin Level |
Less than 0.2EU/ug of rHuMIG/CXCL9 as determined by LAL method. |
Specific Activity |
Fully biologically active when compared to standard. The ED50 determined by a chemotaxis bioassay using human peripheral blood T-lymphocytes is less than 100 ng/ml, corresponding to a specific activity of ＞ 1.0 × 104 IU/mg. |
Storage |
This lyophilized preparation is stable at 2-8 °C, but should be kept at -20 °C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 °C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 °C to -70 °C. Avoid repeated freeze/thaw cycles. |
Formulation |
Lyophilized from a 0.2µm filtered concentrated solution in 20mM PB, pH 7.4, 50mM NaCl. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 °C. Further dilutions should be made in appropriate buffered solutions. |
Physical Appearance |
Sterile Filtered White lyophilized (freeze-dried) powder. |
Usage |
This material is for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. |
Sequence |
TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT |
Document-MSDS: 15344_20120105032308.PDF (PDF)