You are here: Products » Recombinant Proteins » MIG/CXCL9, Human
GenScript Share
 
Search by Catalog Number :
Search by Name :
Search by Sequence : (One letter code)
Search by Category :





Cat. No.
Name
Size   
Price
Selected
Z02822-1
1 mg
$2400.00
Z02822-20
20 μg
$157.00

Full Name MIG/CXCL9, Human
Abbreviated Name-1
MIG/CXCL9, Human;
Documents
MIG/CXCL9, HumanDocument-MSDS: 15344_20120105032308.PDF (PDF)
MIG/CXCL9, HumanDocument-COA: Z02822_R51041204.pdf (pdf)
MIG/CXCL9, HumanDocument-COA: C58501301_Z02822_COA.pdf (PDF)
Figures
Reference
Description
CXCL9, a member of the ª subfamily of chemokines that lack the ELR domain, was initially identified as a lymphokine-activated gene in mouse macrophages. The CXCL9 gene is induced in macrophages and in primary glial cells of the central nervous system specifically in response to IFN-γ. CXCL9 has been shown to be a chemoattractant for activated T-lymphocytes and TIL but not for neutrophils or monocytes. The human CXCL9 cDNA encodes a 125 amino acid residue precursor protein with a 22 amino acid residue signal peptide that is cleaved to yield a 103 amino acid residue mature protein. CXCL9 has an extended carboxy-terminus containing greater than 50% basic amino acid residues and is larger than most other chemokines. A chemokine receptor (CXCR3) specific for CXCL9 and IP-10 has recently been cloned and shown to be highly expressed in IL-2-activated T-lymphocytes.
Source
Escherichia coli.
M.W.
11.7 kDa, a single non-glycosylated polypeptide chain containing 103 amino acids.
Purity
>97% by SDS-PAGE and HPLC analyses.
Endotoxin Level
Less than 0.2EU/ug of rHuMIG/CXCL9 as determined by LAL method.
Specific Activity
Fully biologically active when compared to standard. The ED50 determined by a chemotaxis bioassay using human peripheral blood T-lymphocytes is less than 100 ng/ml, corresponding to a specific activity of > 1.0 × 104 IU/mg.
Storage
This lyophilized preparation is stable at 2-8 °C, but should be kept at -20 °C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 °C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 °C to -70 °C. Avoid repeated freeze/thaw cycles.
Formulation
Lyophilized from a 0.2µm filtered concentrated solution in 20mM PB, pH 7.4, 50mM NaCl.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 °C. Further dilutions should be made in appropriate buffered solutions.
Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Usage
This material is for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE.
Sequence
TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT
1
Custom Recombinant Protein Services: Guaranteed E. coli Expression Package-3 mg purified soluble protein from $2,200 .
2
Bacterial Expression System: GenScript has developed BacPowerTM technologies to tackle hard-to-express and hard-to-dissolve proteins.
3
Yeast Expression System: GenScript's proprietary YeastHIGHTM technology combines the advantages of the bacterial and eukaryotic expression systems.
4
Baculovirus/Insect Cell Expression System: GenScript developed BacuVanceTM platform for the secretion of recombinant proteins from baculovirus-infected insect cells.
5
Mammalian Cell Expression System: The proprietary 293 and CHO suspension system platform promotes fast production and delivery of recombinant proteins and monoclonal antibodies up to grams level.