| Full Name |
MIP-4/CCL18, Human
|
Abbreviated Name-1 |
MIP-4/CCL18, Human; |
|
Description |
CCL18, is a novel CC chemokine that is highly homologous to MIP-1ª (61% amino acid sequence identity). CCL18 cDNA encodes an 89 aa residue precursor protein with a 20 aa putative signal peptide that is cleaved to generate a 69 aa residue mature protein which lacks potential glycosylation sites. In vitro, CCL18 mRNA expression is induced in alternatively activated macrophages by Th2 cytokines such as IL-4, IL-10 and IL-13, and inhibited by IFN-γ. CCL18 mRNA is also expressed by GM-CSF/IL-4-induced monocyte-derived dendritic cells. In vivo, CCL18 is highly expressed in lung and placenta but is not expressed in epidermal Langerhans cells. Recombinant CCL18 has been shown to chemoattract naive T cells, but not monocytes or neutrophils. |
Source |
Escherichia coli |
M.W. |
7.8 kDa, a single non-glycosylated polypeptide chain containing 69 amino acids. |
Purity |
>97% by SDS-PAGE and HPLC analyses. |
Endotoxin Level |
Less than 0.2EU/ug of rHuMIP-4/CCL18 as determined by LAL method. |
Specific Activity |
Fully biologically active when compared to standard. The ED50 determined by a chemotaxis bioassay using human T-lymphocytes is less than 10 ng/ml, corresponding to a specific activity of ＞ 1.0 × 105 IU/mg. |
Storage |
This lyophilized preparation is stable at 2-8 °C, but should be kept at -20 °C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 °C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 °C to -70 °C. Avoid repeated freeze/thaw cycles. |
Formulation |
Lyophilized from a 0.2µm filtered concentrated solution in 20mM PB, pH 7.4, 100mM NaCl. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 °C. Further dilutions should be made in appropriate buffered solutions. |
Physical Appearance |
Sterile Filtered White lyophilized (freeze-dried) powder. |
Usage |
This material is for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. |
Sequence |
AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA |
Document-MSDS: 15382_20120105040207.PDF (PDF)