| Full Name |
MIP-3 Alpha/CCL20, Human
|
Abbreviated Name-1 |
MIP-3 alpha/CCL20, Human; |
|
Description |
MIP-3 alpha/CCL20, also known as LARC (Liver and Activation-regulated Chemokine) and as Exodus, is a CC chemokine that is expressed in the liver, lymph nodes, appendix, PBL and lung and can signal through the CCR6 receptor. MIP-3 alpha is chemotactic towards lymphocytes and dendritic cells. Additionally, it promotes the adhesion of memory CD4+ T cells and inhibits colony formation of bone marrow myeloid immature progenitors. |
Source |
Escherichia coli. |
M.W. |
8.0 kDa, a single non-glycosylated polypeptide chain containing 70 amino acids. |
Purity |
>97% by SDS-PAGE and HPLC analyses. |
Endotoxin Level |
Less than 0.2EU/ug of rHuMIP-3?CCL20 as determined by LAL method. |
Specific Activity |
Fully biologically active when compared to standard. The ED50 determined by a chemotaxis bioassay using human T-lymphocytes is less than 20 ng/ml, corresponding to a specific activity of ＞ 5.0 × 104 IU/mg. |
Storage |
This lyophilized preparation is stable at 2-8 °C, but should be kept at -20 °C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 °C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 °C to -70 °C. Avoid repeated freeze/thaw cycles. |
Formulation |
Lyophilized from a 0.2µm filtered concentrated solution in 20mM PB, pH 7.4, 100mM NaCl. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 °C. Further dilutions should be made in appropriate buffered solutions. |
Physical Appearance |
Sterile Filtered White lyophilized (freeze-dried) powder. |
Usage |
This material is for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. |
Sequence |
ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM |
Document-MSDS: 15384_20120105040344.PDF (PDF)