Mt1 cDNA ORF clone, Rattus norvegicus(Norway rat)

Gene
Clones
gRNAs

Summary

Gene Symbol	Mt1
Entrez Gene ID	24567
Full Name	metallothionein 1
Synonyms	Mt,Mt1a
General protein information	Preferred Names metallothionein 1 Names metallothionein-1 MT-1 MT-I metallothionein 1a metallothionein-I
Gene Type	protein-coding
Organism	Rattus norvegicus(Norway rat)
Genome	Chromosome: 19 Map Location: 19p12
Summary	may play a role in protecting the ovarian tissues from oxidative stress [RGD, Feb 2006].

mRNA and Protein(s)

mRNA	Protein	Name
NM_138826.4	NP_620181.1	metallothionein-1

Pathways from BioSystems
Gene Ontology
Bibliography

Related articles in PubMed

Diabetes Mellitus induces alterations in metallothionein protein expression and metal levels in the testis and liver.
Gu Y, Lian X, Sun W, Gao B, Fu Y
The Journal of international medical research46(1)185-194(2018 Jan)

Brain injury results in lower levels of melatonin receptors subtypes MT1 and MT2.
Osier ND, Pham L, Pugh BJ, Puccio A, Ren D, Conley YP, Alexander S, Dixon CE
Neuroscience letters65018-24(2017 May)

Hippocampal expressions of metallothionein I/II and glycoprotein 96 in EAE-prone and EAE-resistant strains of rats.
Grubi? Kezele T, Blagojevi? Zagorac G, Jakovac H, Domitrovi? R, Rado?evi?-Sta?i? B
Histology and histopathology32(2)137-151(2017 02)

Age-related changes of metallothionein 1/2 and metallothionein 3 expression in rat brain.
Scudiero R, Cigliano L, Verderame M
Comptes rendus biologies340(1)13-17(2017 Jan)

Metallothionein does not sequester arsenic(III) ions in condition of acute arsenic toxicity.
Garla R, Ganger R, Mohanty BP, Verma S, Bansal MP, Garg ML
Toxicology366-36768-73(2016 07)

GeneRIFs: Gene References Into Functions What's a GeneRIF?

acute attack of experimental autoimmune encephalomyelitis was followed by increased expression of metallothioneins in molecular and granular cell layer of hippocampus.
Title: Hippocampal expressions of metallothionein I/II and glycoprotein 96 in EAE-prone and EAE-resistant strains of rats.

After passing middle age we observe a huge increase in MT3 transcripts in both cortical and hippocampal areas, while the MT1/2 mRNA content increases slightly
Title: Age-related changes of metallothionein 1/2 and metallothionein 3 expression in rat brain.

The recurrent seizures plus normal diet group showed worse performances in neurological reflex tests and reduced latencies to myoclonic seizures induced by penicillin compared with the control, which was concomitant with altered expressions of ZnT-7, MT-1, MT-2, and ZIP7.
Title: Long-Term Effects of Ketogenic Diet on Subsequent Seizure-Induced Brain Injury During Early Adulthood: Relationship of Seizure Thresholds to Zinc Transporter-Related Gene Expressions.

Although,there is induction of metallothionein due to arsenic toxicity, the sequestration of arsenic(III) ions by metallothionein was not observed. Therefore, it can be concluded that the sequestration of arsenic by metallothionein in liver is not the mechanism for providing protection in case of acute arsenic toxicity unlike cadmium and other toxic heavy elements.
Title: Metallothionein does not sequester arsenic(III) ions in condition of acute arsenic toxicity.

An inhibitory effect of melatonin on oxytocin secretion from the rat hypothalamo-neurohypophysial system is mediated through a subtype MT1 membrane receptor and its action is independent of subtype MT2 receptor. However, for the stimulatory effect of pharmacological concentration of the pineal hormone on oxytocin release, probably mechanisms other than membrane MT1/MT2 receptor(s)-dependent are involved.
Title: The role of melatonin membrane receptors in melatonin-dependent oxytocin secretion from the rat hypothalamo-neurohypophysial system - an in vitro and in vivo approach.

The following Mt1 gene cDNA ORF clone sequences were retrieved from the NCBI Reference Sequence Database (RefSeq). These sequences represent the protein coding region of the Mt1 cDNA ORF which is encoded by the open reading frame (ORF) sequence. ORF sequences can be delivered in our standard vector, pcDNA3.1⁺/C-(K)DYK or the vector of your choice as an expression/transfection-ready ORF clone. Not the clone you want? Click here to find your clone.

***CloneID	Accession No.	Definition	**Vector	*Turnaround time	Price (USD)	Select
ORa01638	NM_138826.4 Latest version!	Rattus norvegicus metallothionein 1 (Mt1), mRNA.	pcDNA3.1-C-(k)DYK or customized vector	5-7	$69.30 $99.00

ORF Online Only Promotion

Next-day Shipping ORF Clones ( in default vector with tag)
1 Clone	30% OFF
2-4 Clone	40% OFF
5 or more Clone	50% OFF
All Other ORF Clones
30% OFF

*Business Day

** You may select a custom vector to replace pcDNA3.1+/C-(K)DYK after clone is added to cart.

** GenScript guarantees 100% sequence accuracy of all synthetic DNA constructs we deliver, but we do not guarantee protein expression in your experimental system. Protein expression is influenced by many factors that may vary between experiments or laboratories. In addition, please pay attention to the signal peptide, propeptide and transit peptide in target ORF, which may affect the choice of vector (N/C terminal tag vector).

***One clone ID might be correlated to multiple accession numbers, which share the same CDS sequence.

Reference Sequences (Refseq)

Mt1 ( NM_138826.4 ) cDNA ORF clone, Rattus norvegicus(Norway rat) -> NP_620181.1 Rattus norvegicus metallothionein 1 (Mt1), mRNA.

Price & Availability↑

CloneID	ORa01638
Clone ID Related Accession (Same CDS sequence)	NM_138826.4
Accession Version	NM_138826.4 Latest version!	Documents for ORF clone product in default vector
Sequence Information	ORF Nucleotide Sequence (Length: 186bp) Protein sequence SNP
Vector	pcDNA3.1-C-(k)DYK or customized vector	User Manual
Clone information	Clone Map	MSDS
Tag on pcDNA3.1⁺/C-(K)DYK	C terminal DYKDDDDK tags
ORF Insert Method	CloneEZ™ Seamless cloning technology
Insert Structure	linear
Update Date	2019-12-26
Organism	Rattus norvegicus(Norway rat)
Product	metallothionein-1
Comment	Comment: PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from J00750.1. On Nov 23, 2005 this sequence version replaced NM_138826.3. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: J00750.1, BC058442.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMD00052296, SAMD00052297 [ECO:0000348] ##Evidence-Data-END##

ATGGACCCCA ACTGCTCCTG CTCCACCGGC GGCTCCTGCA CCTGCTCCAG CTCCTGCGGC 
TGCAAGAACT GCAAATGCAC CTCCTGCAAG AAGAGCTGCT GCTCCTGCTG CCCCGTGGGC 
TGCTCCAAAT GTGCCCAGGG CTGTGTCTGC AAAGGTGCCT CGGACAAGTG CACGTGCTGT 
GCCTGA

The stop codons will be deleted if pcDNA3.1⁺/C-(K)DYK vector is selected.

RefSeq	NP_620181.1
CDS	70..255
Translation	MDPNCSCSTGGSCTCSSSCGCKNCKCTSCKKSCCSCCPVGCSKCAQGCVCKGASDKCTCCA

Target ORF information:

RefSeq Version	NM_138826.4
Organism	Rattus norvegicus(Norway rat)
Definition	Rattus norvegicus metallothionein 1 (Mt1), mRNA.

Target ORF information:

Epitope	DYKDDDDK
Bacterial selection	AMP^R
Mammalian selection	Neo^R
Vector	pcDNA3.1⁺/C-(K)DYK

NM_138826.4

ORF Insert Sequence:

ATGGACCCCA ACTGCTCCTG CTCCACCGGC GGCTCCTGCA CCTGCTCCAG CTCCTGCGGC 
TGCAAGAACT GCAAATGCAC CTCCTGCAAG AAGAGCTGCT GCTCCTGCTG CCCCGTGGGC 
TGCTCCAAAT GTGCCCAGGG CTGTGTCTGC AAAGGTGCCT CGGACAAGTG CACGTGCTGT 
GCCTGA

The stop codons will be deleted if pcDNA3.1⁺/C-(K)DYK vector is selected.

PubMed

Diabetes Mellitus induces alterations in metallothionein protein expression and metal levels in the testis and liver.
The Journal of international medical research46(1)185-194(2018 Jan)
Gu Y,Lian X,Sun W,Gao B,Fu Y

Brain injury results in lower levels of melatonin receptors subtypes MT1 and MT2.
Neuroscience letters65018-24(2017 May)
Osier ND,Pham L,Pugh BJ,Puccio A,Ren D,Conley YP,Alexander S,Dixon CE

Hippocampal expressions of metallothionein I/II and glycoprotein 96 in EAE-prone and EAE-resistant strains of rats.
Histology and histopathology32(2)137-151(2017 02)
Grubi? Kezele T,Blagojevi? Zagorac G,Jakovac H,Domitrovi? R,Rado?evi?-Sta?i? B

Age-related changes of metallothionein 1/2 and metallothionein 3 expression in rat brain.
Comptes rendus biologies340(1)13-17(2017 Jan)
Scudiero R,Cigliano L,Verderame M

Metallothionein does not sequester arsenic(III) ions in condition of acute arsenic toxicity.
Toxicology366-36768-73(2016 07)
Garla R,Ganger R,Mohanty BP,Verma S,Bansal MP,Garg ML