• English
  • Sign In
  • Contact Us
×
Catalog Products » Other Products » Catalog Peptides » Catalog Peptides - Hot Products » Parathyroid Hormone (PTH) (1-34), Human

Parathyroid Hormone (PTH) (1-34), Human

Synonyms PTH 1-34
Description Parathyroid Hormone (PTH) (1-34) (Human) is a highly purified peptide chemically synthesized by GenScript. Parathyroid hormone is the most important endocrine regulator of calcium and phosphorus concentration in extracellular fluid. This hormone is secreted from cells of the parathyroid glands and finds its major target cells in bone and kidney. Parathyroid hormone accomplishes its job by stimulating at least three processes: mobilization of calcium from bone, enhancing absorption of calcium from the small intestine, suppression of calcium loss in urine. PTH (1-34) is a peptide fragment (34 amino acids) of the naturally occurring human parathyroid hormone that is an important regulator of calcium and phosphorus metabolism.
Cas No 52232-67-4
Sequence
{SER}{VAL}{SER}{GLU}{ILE}{GLN}{LEU}{MET}{HIS}{ASN}{LEU}{GLY}
{LYS}{HIS}{LEU}{ASN}{SER}{MET}{GLU}{ARG}{VAL}{GLU}{TRP}{LEU}
{ARG}{LYS}{LYS}{LEU}{GLN}{ASP}{VAL}{HIS}{ASN}{PHE}
Sequence Shortening SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Molecular Formula C181H291N55O51S2
Molecular Weight 4117.74

Biological Activity 1.02E4 by UMR-106 cell method
Purity > 95%
Endotoxin Level < 2 EU/1 mg
Solubility Parathyroid Hormone (PTH) (1-34) (Human) is soluble in water.
Gmp Flag 0
Storage Before using, store the peptide (PTH) in the DRY form at 4°C. For best and repeatable results, rehydrate the peptide immediately before using. Do not re-freeze any unused portions.
Note

  • Parathyroid Hormone (PTH) (1-34), Human
  • Parathyroid Hormone (PTH) (1-34), Human


Iida-Klein A, et al. Effects of cyclic versus daily hPTH(1-34) regimens on bone strength in association with BMD, biochemical markers, and bone structure in mice. J Bone Miner Res. Feb 2006;21(2):274-282.

Hurley MM, et al. Impaired bone anabolic response to parathyroid hormone in Fgf2-/- and Fgf2+/- mice. Biochem Biophys Res Commun. Mar 24 2006;341(4):989-994.

Narayanan D., et al. In Vitro and In Vivo Evaluation of Osteoporosis Therapeutic Peptide PTH 1-34 Loaded PEGylated Chitosan Nanoparticles. Mol Pharm. 2013 Sep.

Narayanan D., et al. Synthesis, characterization and preliminary in vitro evaluation of PTH 1-34 loaded chitosan nanoparticles for osteoporosis. J Biomed Nanotechnol. 2012 Feb;8(1):98-106.

You can visit "Citations Database" for more citations.







For more documents, please visit "Technical Support".

Cat. No. RP01001
Size
Price
0.5 mg $80.00