• English
  • Sign In
  • Contact Us
×
Home » Gene Synthesis & Molecular Biology Services » β-Amyloid (1-40), rat

β-Amyloid (1-40), rat

Description The effect of beta-amyloid-(1-40) was investigated on long-term potentiation of glutamatergic excitatory postsynaptic field potentials recorded in the inner molecular layer in the rat dentate gyrus in vitro. In the presence of 200 nM beta-amyloid-(1-40) there was an increase in long-term potentiation of 51%. Basal synaptic transmission was not affected. These results provide direct evidence that a relatively low concentration of beta-amyloid-(1-40) increases synaptic plasticity.
Sequence
{ASP}{ALA}{GLU}{PHE}{GLY}{HIS}{ASP}{SER}{GLY}{PHE}{GLU}{VAL}
{ARG}{HIS}{GLN}{LYS}{LEU}{VAL}{PHE}{PHE}{ALA}{GLU}{ASP}{VAL}
{GLY}{SER}{ASN}{LYS}{GLY}{ALA}{ILE}{ILE}{GLY}{LEU}{MET}{VAL}
{GLY}{GLY}{VAL}{VAL}
Sequence Shortening DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Formula C190H291N51O57S1
Molecular Weight 4233.74

Purity > 95%
Gmp Flag 0
Anaspec Cat No Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val
Storage Store at -20°C.
Note


Cat. No.
Product Name
Price
RP10034-1
β-Amyloid (42-1) - 1 mg
$475.00
RP10034-0.5
β-Amyloid (42-1) - 0.5 mg
$285.00
RP10017-1
β-Amyloid (1-42), human - 1 mg
$214.00
RP10017-0.5
β-Amyloid (1-42), human - 0.5 mg
$119.00
RP10013-1
β-Amyloid (1-42), rat - 1 mg
$309.00
RP10013-0.5
β-Amyloid (1-42), rat - 0.5 mg
$176.00
RP10008-5
β-Amyloid (25-35) - 5 mg
$209.00
RP10008-1
β-Amyloid (25-35) - 1 mg
$52.00
RP10004-1
β-Amyloid (1-40) - 1 mg
$190.00
RP10004-0.5
β-Amyloid (1-40) - 0.5 mg
$114.00
RP10002-0.5
β-Amyloid (1-28) - 0.5 mg
$81.00
 
Head E, et al. Immunization with fibrillar Abeta(1-42) in young and aged canines: Antibody generation and characteristics, and effects on CSF and brain Abeta. Vaccine. Apr 2006;24(15):2824-2834.

Bazoti FN, et al. Noncovalent Interaction Between Amyloid-beta-Peptide (1-40) and Oleuropein Studied by Electrospray Ionization Mass Spectrometry. J Am Soc Mass Spectrom. Apr 2006;17(4):568-575.

Qin S, et al. System Xc- and apolipoprotein E expressed by microglia have opposite effects on the neurotoxicity of amyloid-beta peptide 1-40. J Neurosci. Mar 2006;26(12):3345-3356.

You can visit "Citations Database" for more citations.







For more documents, please visit "Technical Support".

Cat. No. RP10016
Size
Price
0.5 mg $157.00